SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9NJW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9NJW2
Domain Number 1 Region: 148-188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000161
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9NJW2
Sequence length 213
Comment (tr|Q9NJW2|Q9NJW2_9APIC) Merozoite surface protein 4/5 {ECO:0000313|EMBL:AAF37358.1} KW=Complete proteome OX=5861 OS=Plasmodium yoelii. GN=PY17X_0305000 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MKITNYLSIINLFVVLLISFKNVHEISLINTKKYQRNIFCAKRILGDPPSANPSTSLNQN
EDNHNSNPDANKGNTNKSDKLNGDNIPNSQSKSENTNLSESPKTGTASNPPQPEPSVQPG
NTNGDSQNSIHSDDEEEDDEDEDDDEEDCSVNNGGCGENLLCEKMESGIIKCSCPSGYKL
NGTSCIELLSAHSVNYCFCGILIILIILVSMIY
Download sequence
Identical sequences Q7R7N9 Q9NJW2 V7PC04
gi|82794512|ref|XP_728466.1| XP_728466.1.76580 2806.m00032|PY07543|PY07543|MSP4/5|p_yoelii|chr_0|MALPY02806|2806 73239.Q7R7N9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]