SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9NPE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9NPE6
Domain Number - Region: 308-422
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0085
Family APC10-like 0.076
Further Details:      
 
Domain Number - Region: 193-224
Classification Level Classification E-value
Superfamily MPN010-like 0.0497
Family MPN010-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9NPE6
Sequence length 437
Comment (sp|Q9NPE6|SPAG4_HUMAN) SUN domain-containing protein 4 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SPAG4; OC=Catarrhini; Hominidae; Homo.
Sequence
MRRSSRPGSASSSRKHTPNFFSENSSMSITSEDSKGLRSAEPGPGEPEGRRARGPSCGEP
ALSAGVPGGTTWAGSSQQKPAPRSHNWQTACGAATVRGGASEPTGSPVVSEEPLDLLPTL
DLRQEMPPPRVFKSFLSLLFQGLSVLLSLAGDVLVSMYREVCSIRFLFTAVSLLSLFLSA
FWLGLLYLVSPLENEPKEMLTLSEYHERVRSQGQQLQQLQAELDKLHKEVSTVRAANSER
VAKLVFQRLNEDFVRKPDYALSSVGASIDLQKTSHDYADRNTAYFWNRFSFWNYARPPTV
ILEPHVFPGNCWAFEGDQGQVVIQLPGRVQLSDITLQHPPPSVEHTGGANSAPRDFAVFG
LQVYDETEVSLGKFTFDVEKSEIQTFHLQNDPPAAFPKVKIQILSNWGHPRFTCLYRVRA
HGVRTSEGAEGSAQGPH
Download sequence
Identical sequences A0A2I3S4D5 Q9NPE6
ENSP00000363391 9598.ENSPTRP00000023066 9606.ENSP00000363391 ENSP00000363391 gi|11037055|ref|NP_003107.1| ENSPTRP00000023066 ENSPTRP00000023066 ENSP00000363391 NP_003107.1.87134 NP_003107.1.92137 XP_003831914.1.60992 XP_514609.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]