SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9P718 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9P718
Domain Number 1 Region: 7-107
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.1e-28
Family Thioltransferase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9P718
Sequence length 109
Comment (tr|Q9P718|Q9P718_NEUCS) Probable glutaredoxin {ECO:0000313|EMBL:CAB88564.1} OX=5141 OS=Neurospora crassa. GN=8D4.220 OC=Neurospora.
Sequence
MSDAATQKAKQLINDNAVVVFSKSYCPYCSNTKQILDGLNAKYATYELNQESDGSDVQDA
LLKLTGQRTVPNIFIGKQHIGGNSDLEAVVKNGKNGKKIQELLQEAGAL
Download sequence
Identical sequences F8MET5 G4UF75 Q9P718
jgi|Neute1|179994|fgenesh2_kg.42__7__524_1_CCGZ XP_009848044.1.73169 5141.NCU01219.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]