SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9PVW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9PVW7
Domain Number 1 Region: 542-587
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000183
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 57-104
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000196
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 119-151
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000484
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 496-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000542
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9PVW7
Sequence length 588
Comment (sp|Q9PVW7|CO8B_PAROL) Complement component 8 subunit beta OX=8255 OS=Paralichthys olivaceus (Bastard halibut) (Hippoglossus olivaceus). GN=c8b; OC=Paralichthys.
Sequence
MFRVAIPRSALNLHSCLLHVTLSLVLISKAAITTAGNEDSDVREARSVSDQQVVHPVDCV
ISDWSAWSRCDTCQKKRYRYAKLDQPSQFGGEPCHFHDMEDEACDVPDRYTCDSIPLCEG
FLCTQTGRCIHRTLQCNGEDDCGDMSDEVGCKKVPKPCRQEAEEYWGIENLAKGINILNS
NLEGLVLDNRYYAGSCLPQYIQDVRFRKPHNLQQYTLETKGSYDFNVQSFESYSDYMDYS
MRERMTQTIVSIGFAIPGIAEFGFNYNNAKVTRSIQKIRRASSKINSFVSAKAELELAQY
MLRSDDLMLHPEFLQRLRSLPQAYVYGEYRQIYRDYGTHYITEAALGGEYEHTIILDKEK
LAKTDYSLEDYKSCTQAGLKIGANIYGVYVSAGIEGGSCNGLLNEMGEDTAIGSSVEDFV
AVVRGGSSESITGLVSKKLPTPQLMRLWGEGVRFNPDFIRKTTRPLYELVTSKDFSHDAT
LKRNLKRALSEYLAESSSCRCAPCHNNGVAVLRGTRCDCVCPTGYTGRGCEITQRKKQIA
TDGSWSCWGAWSSCSGRKMSRSRQCNNPVPSDGGLACRGLQQESTDCF
Download sequence
Identical sequences Q9PVW7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]