SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9QXN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9QXN4
Domain Number 1 Region: 28-285
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.33e-126
Family MioX-like 0.000000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9QXN4
Sequence length 285
Comment (sp|Q9QXN4|MIOX_RAT) Renal-specific oxidoreductase KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Miox; OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MKVDLGPDPSLVYRPDVDPEMAKSKGSFRNYTSGPLLDRVFTTYKLMHTHQTVDFVMRKR
IQFGSFSYKKMTVMEAVDMLDDLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVG
LLHDLGKILALWGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQ
PHCGLENVLMSWGHDEYLYQMMKFNKFSLPSEAFYMVRFHSFYPWHTGGDYRQLCSQQDL
DMLPWVQEFNKFDLYTKCPDLPEVKSLRPYYQGLIDKYCPGILSW
Download sequence
Identical sequences Q9QXN4
GO.59641 NP_665714.2.100692 NP_665714.2.4139 ENSRNOP00000011941 10116.ENSRNOP00000011941 ENSRNOP00000011941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]