SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9QXZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9QXZ7
Domain Number 1 Region: 107-121,163-395
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-65
Family Nuclear receptor ligand-binding domain 0.0000233
Further Details:      
 
Domain Number 2 Region: 38-123
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.76e-29
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9QXZ7
Sequence length 395
Comment (sp|Q9QXZ7|NR2E3_MOUSE) Retina-specific nuclear receptor KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Nr2e3; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MSSTVAASTMPVSVAASKKESPGRWGLGEDPTGVGPSLQCRVCGDSSSGKHYGIYACNGC
SGFFKRSVRRRLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSM
AQVHLDAMETGSDPRSEPVVASPALAGPSPRGPTSVSATRAMGHHFMASLITAETCAKLE
PEDAEENIDVTSNDPEFPASPCSLDGIHETSARLLFMAVKWAKNLPVFSNLPFRDQVILL
EEAWNELFLLGAIQWSLPLDSCPLLAPPEASGSSQGRLALASAETRFLQETISRFRALAV
DPTEFACLKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLL
PSLRFLTAERIELLFFRKTIGNTPMEKLLCDMFKN
Download sequence
Identical sequences Q543C7 Q9QXZ7
NP_038736.1.92730 ENSMUSP00000034831 10090.ENSMUSP00000034831 ENSMUSP00000034831 ENSMUSP00000034831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]