SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9QZK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9QZK2
Domain Number 1 Region: 510-756
Classification Level Classification E-value
Superfamily Ras GEF 1.96e-33
Family Ras GEF 0.014
Further Details:      
 
Domain Number 2 Region: 133-251
Classification Level Classification E-value
Superfamily SH2 domain 4.58e-25
Family SH2 domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9QZK2
Sequence length 820
Comment (sp|Q9QZK2|BCAR3_MOUSE) p130Cas-binding protein AND-34 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Bcar3; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MAAGKFASLPRNMPVNHQFPLASSMDLLSSKSPLAERRTDAYQDVSIHGTLPRKKKGPPS
IRSCDNAGHSKSPRQSSPLTQDIIQENPLQDRKGENFIFRDPYLLDPTLEYVKFSKERHI
MDRTPERLKKELEEELLLSSEDLRSHAWYHGRIPRQVSENLVQRDGDFLVRDSLSSPGNF
VLTCQWKNLAQHFKINRTVLRLSEAYSRVQYQFEMESFDSIPGLVRCYVGNRRPISQQSG
AIIFQPINRTVPLWCLEERYGTSPGRGREGSLAEGRPDVVKRLSLTTGSSIQAREHSLPR
GNLLRNKEKSGSQPACLDHVQDRKALTLKAHQSESHLPIGCKLPPQSPSMDTSPCPSSPV
FRTGSEPTLSPALVRRFSSDARTGEALRGSDSQLCPKPPPKPCKVPFLKTPPSPSPWLTS
EANYCELNPAFAVGCDRGAKLPMQAHDSHEMLLTAKQNGPSGPRNSGINYMILDGDDQAR
HWDPLAVQTDEGQEDKTKFVPPLMETVSSFRPNDFESKLLPPENKPLETAMLKHAKELFT
NHDARVIAQHMLSVDCKVARILEVSEDRKRSMGVSSGLELITLPHGRQLRLDIIERHNTM
AIGIAVDILGCTGTLENRAGTLNKIIQVAVELKDAMGDLYAFSAIMKALEMPQITRLEKT
WTALRHHYTQTAILYEKQLKPFSKILHEGRESTYVPASNVSVPLLMPLVTLMERQAVTFE
GTDMWENNDESCEILLNHLATARFMAEASESYRMNAERILADFQPDEEMTEILRTEFQMR
LLWGSKGAEVNQNERYDKFNQILTALSRKLEPPSGKQAEL
Download sequence
Identical sequences Q9QZK2
NP_038895.1.92730 ENSMUSP00000029766 ENSMUSP00000029766 ENSMUSP00000029766 10090.ENSMUSP00000029766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]