SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9R1C6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9R1C6
Domain Number 1 Region: 216-539
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 4.8e-51
Family Diacylglycerol kinase-like 0.0089
Further Details:      
 
Domain Number 2 Region: 111-176
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000977
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0012
Further Details:      
 
Weak hits

Sequence:  Q9R1C6
Domain Number - Region: 52-101
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000209
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9R1C6
Sequence length 564
Comment (sp|Q9R1C6|DGKE_MOUSE) Diglyceride kinase epsilon KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Dgke; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MEGDQRSGPPAQSLLPDGHLVLWTLCSVLLPVFITLWCSLQRSRRQLHRRDIFRKSKHCW
RDTDLFSHPTYCCVCAQHILQGAFCDCCGLRVDEGCLKKVDKRFPCKEIMLKNDKAADAM
PHHWIRGNVPLCSYCVFCRQQCGSQPKLCDYRCIWCQKTVHDECMRGSLRSEKCDFGEFR
NLIIPPSYLTSINQMRKDKNTNYEGLASKFGKQWTPLIILANSRSGTNMGEGLLGEFKIL
LNPVQVFDVTKTPPIKALQLCTLLPYYSVRVLVCGGDGTVGWVLDAIDEMKIKGQEKYIP
EVAVLPLGTGNDLSNTLGWGTGYAGEIPVAQVLRNVMEADGIKLDRWKVQVTNKGYYNLR
KPKEFTMNNYFSVGPDALMALNFHAHREKAPSLFSSRILNKAVYLFYGTKDCLVQECKDL
NKKIELELDGERVELPNLEGIIVLNIGYWGGGCRLWEGMGDETYPLARHDDGLLEIVGVY
GSFHCAQIQVKLANPFRIGQAHTVRLTLKCSMMPMQVDGEPWAQGPCTVTITHKTHALML
YFSGEQSDDDISSPSDHEDVKEAE
Download sequence
Identical sequences Q9R1C6
ENSMUSP00000000285 ENSMUSP00000000285 ENSMUSP00000000285 ENSMUSP00000103526 10090.ENSMUSP00000000285 NP_062378.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]