SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9RDD1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9RDD1
Domain Number 1 Region: 36-120
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000633
Family Alginate lyase 0.0088
Further Details:      
 
Weak hits

Sequence:  Q9RDD1
Domain Number - Region: 565-790
Classification Level Classification E-value
Superfamily PP2C-like 0.000141
Family PP2C-like 0.015
Further Details:      
 
Domain Number - Region: 389-529
Classification Level Classification E-value
Superfamily GAF domain-like 0.000235
Family GAF domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9RDD1
Sequence length 792
Comment (tr|Q9RDD1|Q9RDD1_STRCO) Uncharacterized protein {ECO:0000313|EMBL:CAB66238.1} KW=Complete proteome; Reference proteome OX=100226 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145). GN=SCO2560 OC=Streptomyces; Streptomyces albidoflavus group.
Sequence
MGAIPTQRETASRASAVPAHTAEASAEGFEECARARVTLLGSSLAPGAARAMVRAALADW
SALGLPGTEQLTEHLAADALVVVSELVTNAVVHAGTDVEVGFQVEGTGALVVEATDQHPS
RAPRSADPETPHDSAEYGRGLRLVAALAEAWGITYRPGTKTVWARLSAPGTDDAGQTEAS
AGGRGARRTDSPGAWPPREGRDGQDGGSGGQYGGQYGGRHGHDDRRSQGGPSALGAPTPD
PAPWAAAPGPEANPGLEASPGLEASPGPEAKPRPETHPGPDVDPDAGADASLDVDPGVSA
DASRDMDPDAGADASPGRRGAPGRRSEPPRWPELPDGVSGTARRGIRDREWLGRGALSFL
AEASDLLAGQLDEDLVASLTGQLIVPRLADWCGVWLEDESLGRGAWTDDTGAAVGARLAR
VWHSGEGHLDELRAALEKDPPRPRDPWRSGPVGHPWPGDALGPDGTHGTALAYRLVAGGR
PLGTLVIGRADTPGALGPTGFPDEITGLVEDLSRRVALAIGAARQYARQATISAVLQRGL
LPGAVAEIPGVRSALVYEPRDKGGPSGDFYDLFPAGDGRWCFAVGDVQGKGPEAAVVIGL
ARPWLRLLAREQYGVPDVLDRLNQLLLDDATEAADAAARALVAAGGPPVAPGDGPQTRFL
SLLYGELVPFDGGVRCTLASAGHPLPLLLGPDGTVSAVACPQTLLGVVEDATYVSETFEL
RSGDTLLCVTDGITERRSGSRQFDDGDGLAAALAGCAGLDAELVAERIRRLVHEFGPRPP
EDDLALLVLQAE
Download sequence
Identical sequences Q9RDD1
NP_626798.1.49638 gi|21221019|ref|NP_626798.1| 100226.SCO2560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]