SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9U3S3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9U3S3
Domain Number - Region: 68-174
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0201
Family Spectrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9U3S3
Sequence length 210
Comment (tr|Q9U3S3|Q9U3S3_CAEEL) THO Complex (Transcription factor/nuclear export) subunit {ECO:0000313|EMBL:CAB54184.1} KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=B0513.2 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MKEDTLLRKLVADGEGVGDDRKVQQIATFFRESRKEDAKTSVPEAVKVTKALEFLELSML
KQKRISHMNKIHATECDQFAEEIDQSIEEMYKKMEVAKNELADAKIVKRNRQEYRKLVNV
LEEVPSRAETTRKLGEVKDDLERQHERQKVLEAKLMDRRNHLQAFMIILSNFQRFCAEDD
DDDAEVMSNPGEDDDAASVTEKQQEDDVRK
Download sequence
Identical sequences Q9U3S3
B0513.2a.1 B0513.2a.2 NP_001255765.1.50509 B0513.2a B0513.2b.2 6239.B0513.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]