SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9U4X0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9U4X0
Domain Number 1 Region: 538-822
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.05e-61
Family Duffy binding domain 0.00000249
Further Details:      
 
Domain Number 2 Region: 221-503
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.19e-46
Family Duffy binding domain 0.00000909
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9U4X0
Sequence length 2647
Comment (tr|Q9U4X0|Q9U4X0_PLAFA) Putative erythrocyte binding protein EBL-1 {ECO:0000313|EMBL:AAD33018.1} OX=5833 OS=Plasmodium falciparum (malaria parasite P. falciparum). GN=ebl-1 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MNVPLNIKFLFFLFCLHCVSSKDQTSEKVKSQKENDSLQVHKKKSGELNNNKSGILRSTY
KRIVGYTQKKLEDLFHVNGEYIKKEEDEKEKVDQNKDMLKSGLMIIDQNKDGEELENLID
PIKSIKDSNNLENYYDDNYNNIKFDVGNKSNHLKYMKTRNSDSDERFSNYYFIDNNLFLR
DNKEQDENVFLSKSIIRNKDVDISIKDFEKNKFIDTYSLYECGKKIKEMKWICTDNQFKS
NNLCAPIRRIQLCIVNIILFSENENEYIYKNDSINNKFKENILKAVKLESNLLVQKHNNE
YNSKLCDDIRWSFLDYGDIIIGRDLIYKNNTDYIKEQFKKIFNNEYNNNELNDELNNELN
DEKNIKLRKEWWEKYKEDIWEEMTKEHNDKFIEKCKYFAKDEPQIVRWIEEWSKQFLDEK
NYMLFTLRNTYNEMNIIHENNCKQYNKWVQNRKKEWTFLSNEFNKIFPERNVQTHISNIF
KEYKENNVDIIFGTLNYEYNNFCKEKPELVSAAKYNLKAPNAKSPRIYKSKEHEESSVFG
CKTKISKVKKKWNCYSNNKVTKPEGVCGPPRRQQLCLGYIFLIRDGNEEGLKDHINKAAN
YEAMHLKEKYENAGGDKICNAILGSYADIGDIVRGLDVWRDINTNKLSEKFQKIFMGGGN
SRKKQNDNNERNKWWEKQRNLIWSSMVKHIPKGKTCKRHNNFEKIPQFLRWLKEWGDEFC
EEMGTEVKQLEKICENKNCSEKKCKNACSSYEKWIKERKNEYNLQSKRFDSDKKLNKKNN
LYNKFEDSKAYLRSESKQCSNIEFNDETFTFPNKYKEACMVCENPSSSKALKPIKTDVFP
IEETKKSELSSLTDKSKNTPNSSGGGNYGDRQISKRDDVHHDGPKEVKSGEKEVPKIDAA
VKTENEFTSNRNDIEGKEKSKGDHSSPVHSKDIKNEEPQRVVSENLPKIEEKMESSDSIP
ITHIEAEKGQSSNSSDNDPAVVSGRESKDVNLHTSERIKENEEGVIKTDDSSKSIEISKI
PSDQNNHSDLSQNANEDSNQGNKETINPPSTEKNLKEIHYKTSDSDDHGSKIKSEIEPKE
LTEESPLTDKKTESAAIGDKNHESVKSADIFQSEIHNSDNRDRIVSESVVQDSSGSSMST
ESIRTDNKDFKTSEDIAPSINGHEKIGSSADDRGSEDKSIIDKDSENFENNKSSHSDIKQ
SDNEGSTDYESLTEESPKGDLESVSPSSIDMDLKPNKSSPVTSFDHVDSPNISELQSASQ
NADSYQGEKPSKNILRTDGDVSEKEKISVSPPNVSVTYDEGDKRQGISDDSSIHHEIDPE
KNLHYESFISEGGLEEGDIEKEKGKEDGSLIPISPEKINDFGKRENIVDPSVSERVDDNR
SDISNVVSEEQESSIISSRNGTEGINNSEELKSEEHTSVDVNNRDEHNKQENLVSSSTQQ
ESEREKREKKENADSSHESELSSISEVGETIRRNDAEASENDKGEDILQSEEQQIVTEKT
KLIEPTVNILQPSTPLGEIHKEKSEEIDDKDNTGGEVTHTDANTFQYRSSESVEVITNKP
DEMEMTTKPPSQYIEKEIGEIDSTKNQDNDEQSNSIIPLINKNNEEDGVSIPSTRNVMES
GSFVSRNEQIIEEKDDKHITDDTTINPSENGLKGYGEMPNDSIKSVTITESPLRDVEQMI
EPIDGKGNEKNNIIGEPQESTTEIRKQMDGPISNVNIPEELHPVAEGSKLEEAKERSMDD
ADKGTITEDITVVEDPNGIGEHQNLKEVHEQASELNTYNSLDGRTNVEVKERLDENPGSI
PNDRITTEHIELDKEKEIHEPNELDAHNGEQEEMIRNEVSDNRMDEQISRDNETRQLNQD
HESDSKDEIIDKREMENLEENPNSSSDSLENPEGKEKGKIEHTHSSEELDSVRDETYKYK
GIENQITETEIESVEQQDTNIPGNSKETEVDNSRADMEEEKDVKIKQIITEESEEELEIS
KDTTTSHSEKPSIEEQSVNIVDSKNEINVQIEKNVQNEQNEGDPIILLEEQNKNIAILEN
QKNEYNNPSQLSHKERTLLEVDDLEGSMDTNCLTSELNKNKCDSIQIIPEASNTDNKLNK
DITENKDDFSEIEKSVGEIHENGKDLLNKESAESDDVPVQNKIEHDSENAGVIDQYEYRT
DYEENEKVNFVGLPGKPEEERSDVTRGSVPGSVDAFEKKLHEPLDSNEKNKEELNVSKEI
EYPVGLDILGIDSESSDSVTIYKRPTDTFVENVHVLSRDIKSLFENEKTVGLNEQKKETE
KNIAGGMIDVLNNKNIDDDQSVRLSTSLYHKGLDDDQSGRLSTALYDKGLDDDQHYLHDN
SYNNNINNIKNEVQCKENCGRNENVSSFVDTTTLRDVKQNKEHTEETKLIENTKIDNTEV
DDGVDITSDNRSSFISVDNYDEKKKETIINEKKNDPKPSRKEEKDVKHDDSENDNNNLSS
NIKIKERIENIYNYIKKLFNLTDINNYTEKKDMPRYNLNNFINTKSYTLFENSKESEYHG
NELLQSENIPEHHNKSNNIKVSSNLDNNYYRYVNKILEDIINLSKKKKKSINDTSFEYCE
SILRHSISSSSIYKDELKYLCFSILYYCLIYFDNTSEYYNCITNEFNNTLYIMFQTDMTS
MIYNIYK
Download sequence
Identical sequences Q9U4X0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]