SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9UBW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9UBW5
Domain Number 1 Region: 30-235
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.72e-62
Family BAR domain 0.0000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9UBW5
Sequence length 565
Comment (sp|Q9UBW5|BIN2_HUMAN) Breast cancer-associated protein 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=BIN2; OC=Catarrhini; Hominidae; Homo.
Sequence
MAEGKAGGAAGLFAKQVQKKFSRAQEKVLQKLGKAVETKDERFEQSASNFYQQQAEGHKL
YKDLKNFLSAVKVMHESSKRVSETLQEIYSSEWDGHEELKAIVWNNDLLWEDYEEKLADQ
AVRTMEIYVAQFSEIKERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKTAKAEEEFNKA
QTVFEDLNQELLEELPILYNSRIGCYVTIFQNISNLRDVFYREMSKLNHNLYEVMSKLEK
QHSNKVFVVKGLSSSSRRSLVISPPVRTATVSSPLTSPTSPSTLSLKSESESVSATEDLA
PDAAQGEDNSEIKELLEEEEIEKEGSEASSSEEDEPLPACNGPAQAQPSPTTERAKSQEE
VLPSSTTPSPGGALSPSGQPSSSATEVVLRTRTASEGSEQPKKRASIQRTSAPPSRPPPP
RATASPRPSSGNIPSSPTASGGGSPTSPRASLGTGTASPRTSLEVSPNPEPPEKPVRTPE
AKENENIHNQNPEELCTSPTLMTSQVASEPGEAKKMEDKEKDNKLISANSSEGQDQLQVS
MVPENNNLTAPEPQEEVSTSENPQL
Download sequence
Identical sequences Q9UBW5
ENSP00000410217 9606.ENSP00000267012 gi|49472835|ref|NP_057377.2| ENSP00000267012 ENSP00000267012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]