SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9UME2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9UME2
Domain Number 1 Region: 4-44
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000419
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9UME2
Sequence length 49
Comment (tr|Q9UME2|Q9UME2_HUMAN) Dystrophin {ECO:0000313|EMBL:AAB53001.1} OX=9606 OS=Homo sapiens (Human). GN=DMD OC=Catarrhini; Hominidae; Homo.
Sequence
RFDRSVEKWRRFHYDIKIFNQWLTEAEQFLRKTQIPENWEHAKYKWYLK
Download sequence
Identical sequences Q9UME2
ENSGGOP00000021464 ENSGGOP00000021464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]