SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9V3G1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9V3G1
Domain Number 1 Region: 99-246
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 3.74e-52
Family C-terminal domain of ribosomal protein L2 0.00000698
Further Details:      
 
Domain Number 2 Region: 2-97
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.42e-21
Family Cold shock DNA-binding domain-like 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9V3G1
Sequence length 256
Comment (sp|Q9V3G1|RL8_DROME) 60S ribosomal protein L8 KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=RpL8; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MGRVIRAQRKGAGSVFKAHVKKRKGAAKLRSLDFAERSGYIRGVVKDIIHDPGRGAPLAV
VHFRDPYRYKIRKELFIAPEGMHTGQFVYCGRKATLQIGNVMPLSQMPEGTIICNLEEKT
GDRGRLARTSGNYATVIAHNQDTKKTRVKLPSGAKKVVPSANRAMVGIVAGGGRIDKPIL
KAGRAYHKYKVKRNSWPKVRGVAMNPVEHPHGGGNHQHIGKASTVKRGTSAGRKVGLIAA
RRTGRIRGGKGDSKDK
Download sequence
Identical sequences A0A0J9RP44 A0A1W4VPJ2 B3NBJ4 B4HTE0 B4PDD9 Q9V3G1
7227.FBpp0072802 7245.FBpp0265334 FBpp0072801 FBpp0265334 FBpp0072801 FBpp0072802 FBpp0072801 FBpp0072802 4v6w_CA 7292250___KOG2309 FBpp0195972 FBpp0133416 NP_524726.1.81976 NP_728756.1.81976 XP_001971290.1.56816 XP_002035075.1.34323 XP_002094207.1.41174 XP_016030081.1.80810 XP_016933238.1.48971 XP_016966788.1.21709 XP_016970462.1.97277 XP_016970468.1.97277 XP_017058073.1.74164 XP_017071610.1.81094 XP_017071611.1.81094 XP_017127418.1.32376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]