SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9V3G7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9V3G7
Domain Number 1 Region: 285-366
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.37e-17
Family PCI domain (PINT motif) 0.062
Further Details:      
 
Weak hits

Sequence:  Q9V3G7
Domain Number - Region: 84-213
Classification Level Classification E-value
Superfamily TPR-like 0.0129
Family Tetratricopeptide repeat (TPR) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9V3G7
Sequence length 389
Comment (sp|Q9V3G7|PSMD6_DROME) Protein Rpn7 KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=Rpn7; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MPAENLEEQGLEKNPNLELAQTKFLLTLAEYKQDAALKAKLLEAIRTENMAPWYEHICSE
LGWTVDKDLLARMKENNRVEVEQLDAAIEDAEKNLGEMEVREANLKKSEYLCRIGDKAAA
ETAFRKTYEKTVSLGHRLDIVFHLIRLGLFYLDHDLITRNIDKAKYLIEEGGDWDRRNRL
KVYQGVYSVAVRDFKAAATFFLDTVSTFTSYELMDYPTFVRYTVYVAMIALPRNELRDKV
IKGSEIQEVLHGLPDVKQFLFSLYNCQYENFYVHLAGVEKQLRLDYLIHPHYRYYVREMR
ILGYTQLLESYRSLTLQYMAESFGVTVEYIDQELARFIAAGRLHAKVDRVGGIVETNRPD
NKNWQYQATIKQGDLLLNRIQKLSRVINI
Download sequence
Identical sequences B4R021 Q9V3G7
FBpp0216858 7300859___KOG0687 FBpp0083687 FBpp0083687 FBpp0083687 7227.FBpp0083687 NP_651048.1.81976 XP_002104424.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]