SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9V3Q0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9V3Q0
Domain Number 1 Region: 33-181
Classification Level Classification E-value
Superfamily L domain-like 2.31e-30
Family Internalin LRR domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9V3Q0
Sequence length 182
Comment (tr|Q9V3Q0|Q9V3Q0_DROME) IP06404p {ECO:0000313|EMBL:AAY85012.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG10839 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSKPTTLKDALAKWEDRNKQPAATATEIGLQFQYPPIEKMDPILNSLTECQKLSLSSNMI
EKITGISGMKNLKVLSLARNNLKTLNGIEPLADTLEELWVSYNNIEKTKPLESMKALRVF
YISFNMIKDWTEFMRMGVPPNLSEITFVGNPLNENMDQSAFTAEAVRRLPNMKKLDGEPV
IR
Download sequence
Identical sequences Q9V3Q0
7227.FBpp0080358 NP_001246039.1.81976 NP_001285969.1.81976 NP_609776.1.81976 FBpp0080358 FBpp0080358 FBpp0080358 FBpp0294014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]