SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9V477 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9V477
Domain Number 1 Region: 366-698
Classification Level Classification E-value
Superfamily L domain-like 1.6e-50
Family Ngr ectodomain-like 0.0055
Further Details:      
 
Domain Number 2 Region: 209-446
Classification Level Classification E-value
Superfamily L domain-like 1.63e-47
Family Ngr ectodomain-like 0.0065
Further Details:      
 
Domain Number 3 Region: 1071-1214
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.88e-42
Family Toll/Interleukin receptor TIR domain 0.0000719
Further Details:      
 
Domain Number 4 Region: 810-950
Classification Level Classification E-value
Superfamily L domain-like 1.08e-31
Family Ngr ectodomain-like 0.0051
Further Details:      
 
Domain Number 5 Region: 45-275
Classification Level Classification E-value
Superfamily L domain-like 9.35e-22
Family Ngr ectodomain-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9V477
Sequence length 1346
Comment (sp|Q9V477|TOLL8_DROME) Toll-like receptor 8 {ECO:0000305} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG6890 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MLATTHMLYVLIATCVIPIFGAALSKTVLYQAPDECRWSGGGEHDITLVCHLRTINSELE
NTNFSVIQPQNTVRLRLECNDALFFQSSLSPDSFRSLVELRDLTIEYCKLGNLTDGSFRG
LQELRNLTIRTHNGDWSTMSLEMASNSFVEFRQLERLDLSLNNIWLIPDGMVCPLKSLQH
LNASYNKIQDISNFYFSASLSSRKARVCGSTLQSLDLSANKMVSLPTAMLSALGRLTHLN
MAKNSMSFLADRAFEGLLSLRVVDLSANRLTSLPPELFAETKQLQEIYLRNNSINVLAPG
IFGELAELLVLDLASNELNSQWINAATFVGLKRLMMLDLSANKISRLEAHIFRPLASLQI
LKLEDNYIDQLPGGIFADLTNLHTLILSRNRISVIEQRTLQGLKNLLVLSLDFNRISRMD
QRSLVNCSQLQDLHLNDNKLQAVPEALAHVQLLKTLDVGENMISQIENTSITQLESLYGL
RMTENSLTHIRRGVFDRMSSLQILNLSQNKLKSIEAGSLQRNSQLQAIRLDGNQLKSIAG
LFTELPNLVWLNISGNRLEKFDYSHIPIGLQWLDVRANRITQLGNYFEIESELSLSTFDA
SYNLLTEITASSIPNSVEVLYLNDNQISKIQPYTFFKKPNLTRVDLVRNRLTTLEPNALR
LSPIAEDREIPEFYIGHNAYECDCNLDWLQKVNRESRTQPQLMDLDQIHCRLAYARGSSH
VSLIEAKSDDFLCKYASHCFALCHCCDFQACDCKMECPDRCSCYHDQSWTSNVVDCSRAS
YEQTLPSHIPMDSTQLYLDGNNFRELQSHAFIGRKRLKVLHLNHSRIEVLHNRTFYGLLE
LEVLQLQSNQLKALNGNEFQGLDNLQELYLQHNAIATIDTLTFTHLYHLKILRLDHNAIT
SFAVWNFLPSYLNELRLASNPWTCSCEFIDKLRDYINRHEYVVDKLKMKCDVISGNSTQQ
MVIYPGSGEPASLPVVQCSQTLPLGLDNNFNYAEQAGGENASNATSTKMILNQPPKLDYI
PILVAILTAFIFVMICISLVFIFRQEMRVWCHSRFGVRLFYNAQKDVDKNEREKLFDAFV
SYSSKDELFVNEELAPMLEMGEHRYKLCLHQRDFPVGGYLPETIVQAIDSSRRTIMVVSE
NFIKSEWCRFEFKSAHQSVLRDRRRRLIVIVLGEVPQKELDPDLRLYLKTNTYLQWGDKL
FWQKLRFALPDVSSSQRSNVAGQSCHVPINHASYHHHHHVHQQAMPLPHSVHHHQQQFML
PPPPQQPGSFRRQPSLHQQQQQQQQIRGNNNTTQQQQQQQAALLMGGGSVGGPAPQMIPL
AGGIQQQSLPLPPNQQPTPASRNLHM
Download sequence
Identical sequences Q9V477
FBpp0075360 NP_524757.1.81976 FBpp0075360 7227.FBpp0075360 FBpp0075360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]