SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9V831 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9V831
Domain Number 1 Region: 20-169
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.06e-49
Family APC10-like 0.00000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9V831
Sequence length 195
Comment (sp|Q9V831|APC10_DROME) Cyclosome subunit 10 KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=APC10; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MAASMDEDITANPPPSSEEDPLAEERLGFVREVGAQAVWSLSSCKPGFGVERLRDNIMDT
YWQSDGQLPHLVNIQFHKRTNISQIYIYTDYKLDESYTPSRISIRSGTNFNDLQELQVMD
LTEPTGWVQIPIKDGNVKSIRTFMLQIAVISNHQNGRDTHMRQIRIHAPVEGKHYPLELF
GKFGTVDFQKFATIR
Download sequence
Identical sequences B4HMV6 B4QAV7 Q9V831
FBpp0086107 FBpp0201451 7227.FBpp0086107 NP_611223.4.81976 XP_002034293.1.34323 XP_002081923.1.80810 FBpp0086107 FBpp0086107 FBpp0223872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]