SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9V895 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9V895
Domain Number 1 Region: 8-148
Classification Level Classification E-value
Superfamily L domain-like 4.08e-29
Family Internalin LRR domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9V895
Sequence length 261
Comment (sp|Q9V895|AN32A_DROME) Acidic leucine-rich nuclear phosphoprotein 32 family member A KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=Anp32a; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MEKRIELERRARKVNQITELNLDNCRSTSIVGLTDEYTALESLSLINVGLTTLKGFPKLP
NLKKLELSDNRISSGLNYLTTSPKLQYLNLSGNKIKDLETLKPLEEFKNLVVLDLFNNDA
TQVDNYREKIFKMLPSLNFLDGFDCNDEEVQSDGDDDDEVNGNDSDEVGVSDEDDDSDDS
DEEANGEVSLSEVYNDDLEEDNSDWEGEDEAGEEDEEEDSDIDDADGDANESAASVNAKD
KDGEKEADESQVRGKKRKHDG
Download sequence
Identical sequences B7YZR7 Q9V895
NP_523780.1.81976 NP_725732.1.81976 FBpp0086001 FBpp0086002 FBpp0086001 FBpp0086002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]