SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9V9R6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9V9R6
Domain Number 1 Region: 454-719
Classification Level Classification E-value
Superfamily TPR-like 2.69e-16
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Domain Number 2 Region: 184-327,429-474
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000131
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9V9R6
Sequence length 840
Comment (tr|Q9V9R6|Q9V9R6_DROME) No mechanoreceptor potential B, isoform C {ECO:0000313|EMBL:AAF57219.4} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG12548 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MTSQITANGTQRLPEPVSEHEAVPPPPPTAAGRPRPPTSQLFSRGNLASSRATGGDKSGL
ARPSTAVRAVGYAANCESAHQRFEQFFLEKAKQQTLSSRAAVDAIKDVNPQMKYKNLEEK
IVKLLESSIVLAWQGSPNKLLNLDTKLAEALSKAKEAFSLDRTLHQFRDQHGENVYHNFD
LTYAVFFNLAEQYERSEMHIEALNTYSIMAKNKMFPHVNQLKLNMGNIYYSMGIYQKAVK
MYRMALDSVPKSLSQLRLKIRENIGILFIRMGSYSDAASSFEFIMTERANIRSSIHLLLC
YFALGDVEKVKLAFRRLCDVQTEAIESDMESETNIIKLQQQAEPIQQIGETDGYQSLNNE
PVTGSVIKAEGGGKLNETVKFAATVKHRYVVQALKKDELAVYRNERRNAVKRSITMIVDL
ISPFIEDNYNDGYNWCIEIIKTSNLAWLANELELNKALVYLRQNDVHQAIETLQMYDRKS
EGSMTASALTNLSFIYISLGNLEMASHCVNQLHEIGSLKNNAPGLINAGIVELGSHNLIL
ASERFEGALQLQPMNFEARYNLGLVALAQNDYELAEERFELLKEQLMLPSSVQHSHVFYQ
LAKLQERRLESGLISNFTPGAALQAYLQVVGISASDIDSRLFEKVGSLYEQIQDHQEANQ
YYNEAYRINMSDIGIASSIGSYYIKLQATERALFYYERAVLADPNDPNLMLRIASCFRNS
YLPTKQYLGLFQKIHARFPDNLTCIRALMQVTKSLELGDLYERYASEYTRLQSQQQERQS
EQRYQQQRFPSAAKFSNRLRFLQFDPLGPPAERPKTGRPLQSRDDVDDDAEMNPESLLPI
Download sequence
Identical sequences Q9V9R6
FBpp0290395 NP_523613.4.81976 FBpp0290395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]