SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VB06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VB06
Domain Number 1 Region: 14-333
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.79e-42
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VB06
Sequence length 398
Comment (tr|Q9VB06|Q9VB06_DROME) Uncharacterized protein {ECO:0000313|EMBL:AAF56739.3} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG43320 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MELSSKLRDLILNTHVPLVLEQFPLKWECFEGSLHDWCKRFDKEATCLPAFELMALADSS
TPQWERKRTKSSQLLNMQQFLRKYGVLDGDSTHWAAYQYKKADEVPLSCRSGIGFSSFGF
PDIGNDYRFWLGSEQANTPCHYDTFGVNIVVQVHGCKSWLLFPPETPLQSTRIPYEETSV
YCLENFYAPDPAKISSYEHLGRQAYHCNLQPGNVLIVPRHWWHYVEAKSTSLSVNYWVPL
KVDMDLILDEFLVMHIVESFVRGESNQVKQYLLNPNQLDNVSTKPSDLFAQFEQAVQNLE
SGKSTRQLYDTDYISQADWKTLLNSINLSVRPLEVMPHEEYKLLLNANSKRFRVAANPPE
TTPISSNCELLVSSMCAPRVIAEMKREFFRRLGKSNSL
Download sequence
Identical sequences Q9VB06
FBpp0297777 FBpp0297777 NP_651581.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]