SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VBZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VBZ6
Domain Number 1 Region: 169-377,439-689
Classification Level Classification E-value
Superfamily TPR-like 2.66e-69
Family Tetratricopeptide repeat (TPR) 0.00055
Further Details:      
 
Domain Number 2 Region: 771-836,874-939
Classification Level Classification E-value
Superfamily PIN domain-like 0.000000000569
Family PIN domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VBZ6
Sequence length 948
Comment (tr|Q9VBZ6|Q9VBZ6_DROME) Smg6 {ECO:0000313|EMBL:AAF56380.2} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG6369 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSRKGTREQNDISLIIGTLPKRLQNKIAASCSHAAAAATTTKALETENAENAEPVATTAN
ASRPVEILSNASTGGGKPDAQSKQPVLDTSGKMAWEGGIPGILRVTTSVAGDVNRNGQGQ
GKNKSGNSARRRGRKDKEHATQSPVTRTRLTTEHPDWFEPLLGLPHAKNIVHLYDQLMVL
NQRNLILINWKNFCYIHDQLQDAFKQLLLEQLKFVCEHKVDVFFWKLLFYNVRNYLKRQQ
TDQAHTHTLLLIEQAIKFYRMLYDKLMAKCVASSRCDSALKVVAQRLLICLGDLTRYRVN
HVKATDYMEAARYYQRAQELVPGNGAPFNQLAVISIYHHKRFDAVYYYVRSLLTSNSIQS
AKESLLDLFDEIRRKYEETEMKQSPMHYAAGSKNQKSKQMRKEVWIYPDGIRRLHRTDDK
GNKAKGNKATMAEVNRYEEMPPEEILPRIVSLYLYLLGKLYTGTDVDSLYPLLRKLQIQI
GVALRHENLLSRSKLLKIVALNLFVVEHNKPKTSRREMRYHSFNFANSFFGLMMKKTNQL
LAGFVEDSTNVQCLPEEDFATVNTYLQFVNVYVRWLSISLDVWEPVRSEEHSFIDCWAEL
TILFEYIECLMGKHKLEKNEILLDEDVALRGFTPLGRETLSMDYLKRGSERLQFFERVRR
IGQFQEYYVQHQEALQQPLESSFTVEHLNAAMKNALENYDAESCGLAANVSKIQCKAVEE
LLCRSTDSDVSELCKLKKELEAKARVKQICTSKLEDILKFVDTKIYIEVRPRYLLPDTNC
FIDCLEDFEKLSTEFKRYTLIIPLTVVKELDGLSKGVKLDSYRSSKQTQRIHHFDEVSSR
AKKSLEFIKSAKGNVKCATTKGSFVNASVFALVEEEYLSNDDKILATAMAVSKTAKTEQC
TDGKCFIQTELVLITTDRNLRVKALSRNLAVSALDEFLQWAKDCREST
Download sequence
Identical sequences Q9VBZ6
FBpp0084171 7227.FBpp0084171 FBpp0084171 FBpp0084171 NP_651321.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]