SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VC47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VC47
Domain Number 1 Region: 522-720
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.79e-54
Family Astacin 0.0000807
Further Details:      
 
Domain Number 2 Region: 1162-1271
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-38
Family Spermadhesin, CUB domain 0.00033
Further Details:      
 
Domain Number 3 Region: 849-952
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.13e-36
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 4 Region: 997-1112
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-32
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 5 Region: 1271-1391
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-28
Family Spermadhesin, CUB domain 0.00064
Further Details:      
 
Domain Number 6 Region: 717-841
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-24
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 7 Region: 1112-1155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000628
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 950-995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000016
Family EGF-type module 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9VC47
Sequence length 1464
Comment (tr|Q9VC47|Q9VC47_DROME) Metalloendopeptidase {ECO:0000256|RuleBase:RU361183} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG6863 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MRRRRGTPLGVSWTNCVLLLATGLLVVLISVHAKNPRPHRGLPAPAPAPVPASVDQVATE
NAHRREPTVDGSVLQRLSGSDRAVDEDEDVDEDEDEGLKHQHLEHRQQFDAYLGTIRRLR
RPYRSKYTIEQLMRLHVTPKVSGDIDMDPCKAGGFMGDIALPEGDSGPVVAHTPIDDEEQ
ERQEVEQLLADSPSPVHDPPSVSGAANSGPTKFNATFQLDLEKLKQEVYHEGLQVEEEGL
TDIIRKKTKLPSSGPVNLKAGQSQSQSQSANEPVKPGSESPSDYAQASSYKNEVLPPSEQ
RIHTDKPARLTLAEIGPKFSNKTQSLHRNVDTRKIQSDNKDIEDDSGNNFVAERRPSQIV
PTSLPEQRSTPAHVYSNAGGNGMQLDDEVDFLHSRGVVRRRHRRGPKQRRSNQHLEHEVK
LQRLREELSRPVIEAHHHQSHHQKQAQHRQHHQSHHRKKHRRQQQHHRRRGQSTTQYVNH
SPPGFNQSQQAQQQSVPEMDLLKAETSKDEEPLRHRVARAVTAKKERIWDYGVIPYEIDG
NFSGIHKALFKLAMRHWENSTCIKFVERDPEIHPNYIVFTVRSCGCCSFVGKRGNGPQAI
SIGRNCDKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYNFNMLSPDEVDS
LGMAYDYDSIMHYARNTFSKGTYLDTILPIEMKGRKRPEIGQRLRLSQGDIAQANLLYKC
PKCGRTFQESSGIFASPSHYTAGALSNETEHCEWRITATYGERVELKLENMNIFKSNNCE
TDYLEIRDGYFEKSPLIGRFCGKVDKEVIRTESSRMLLTYVNTHRIEGFRGFKAEFDVVC
GGELSVDDAVGRLESPNYPLDYLPNKECVWKITVPESYQVALKFQSFEVENHDSCVYDYV
EVRDGPGQDAPLIGVFCGYKPPPNMKSSGNSMYVKFVSDTSVQKAGFSAVFMKEVDECET
QNHGCEHECINTLGGYECSCRIGFELHSDKKHCEDACGGVIEYPNGTITSPSFPEMYPLL
KECIWEIVAPPKHRISLNFTHFDLEGTAHQQSDCGYDSVTVYSKLGENRLKRIGTFCGSS
IPPTATSESNALRLEFHSDKSIQRSGFAAVFFTDIDECAVNNGGCQHECRNTIGSYICMC
HNGYSMHENGHDCKEGECKYEISAPFGTIFSPNYPDSYPPNADCVWHFITTPGHRIKLIF
NEFDVESHQECTYDNVAVYDGESESSSVLGRFCGDKIPFPISSTSNQMYMVLKTDKNKQK
NGFTASHSTACGGYLRATSQVQQFYSHARFGNQDYDDGMDCEWTIAAPDNSYVQLIFLTF
DIESSENCTFDYVQVFSDIDDVYGQYGPMYGQYCGNVLPQDINSMTHSLLVRFKTDGSVP
MKGFSASYVAVPNSGEYDHSDEDVENSYSSEMVTPFPGSLKSIYIEDTQEETDEYSDFSG
NQLVFNGQYRGRYSLPKRYYSGKA
Download sequence
Identical sequences Q9VC47
FBpp0084068 FBpp0084069 FBpp0084068 7227.FBpp0084068 NP_001287510.1.81976 NP_476879.1.81976 NP_733035.1.81976 FBpp0084068 FBpp0084069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]