SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VCB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VCB6
Domain Number 1 Region: 185-528
Classification Level Classification E-value
Superfamily DNase I-like 4.97e-38
Family DNase I-like 0.078
Further Details:      
 
Domain Number 2 Region: 42-157
Classification Level Classification E-value
Superfamily L domain-like 1.26e-19
Family Ngr ectodomain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9VCB6
Sequence length 545
Comment (tr|Q9VCB6|Q9VCB6_DROME) Twin, isoform B {ECO:0000313|EMBL:AAF56256.2} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG31137 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSRNKDKYDSANRRQQIFLSQEDIAAGKKTNWSGLEITGCVRNISPSLWEFEHLTALYLN
DNQLLRLPADVGMLTSLRTLDLSSNKLRSLPAELGELIQLRELLLNNNFLRVLPYEIGKL
FHLVILGLMGNPLQKEFMNIYNEPNGTQKLLTYMLDNLSFTVNPPPQRPWLPLAKPNKTR
PACIFTVMCYNVLCDKYATRQMYGYCPSWALCWEYRKKSIIDEIRHYAADIISLQEIETE
QFYHFFLPELKNDGYEGIFSPKSRAKTMSELERKYVDGCAIFFRASKFTLIKESLIEFNQ
LAMANAEGSDNMLNRVMPKDNIGLAALLKVKENAWEPMSEVTQISQPLLVCTAHIHWDPE
FCDVKLIQTMMLSNELKTIIDEASHSFRPGHKNDSNAVQLLLCGDFNSLPDSGVVEFLGK
GRVSMDHLDFKDMGYKSCLQRLLSNDTNEFTHSFKLASAYNEDIMPHTNYTFDFKGIIDY
IFYTKTGMVPLGLLGPVSNDWLRENKVVGCPHPHIPSDHFPLLVELELMHTASQQAPPNG
LINRR
Download sequence
Identical sequences Q9VCB6
FBpp0083952 NP_732967.1.81976 XP_016036007.1.80810 FBpp0083952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]