SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VCQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VCQ3
Domain Number 1 Region: 9-347
Classification Level Classification E-value
Superfamily V-type ATP synthase subunit C 3.14e-67
Family V-type ATP synthase subunit C 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VCQ3
Sequence length 350
Comment (sp|Q9VCQ3|VA0D2_DROME) Vacuolar proton pump subunit d 2 KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=VhaAC39-2; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSMIFNTEYGYLEALTRGFKNGMLKHSDYLNLTQCESLEDVMISIQGTDYGLIFGGEQSA
PSVEVIERCLRDRLLQQYYYIRSHSTEPLTTFMEFIRYPFMIDNVALLVAGLNNHRSMKR
LLRMCHPLGEFDQLGAIEVASNSAELFDAVLIDTPIARFVPRDLPMESLRYLDVEIVRAH
LYRAYLEKFYAYCSQLGGNTANVMTNLLSFEADRRTITIAVNAIGSDIIPKERLKMFPTC
GYLPKIALASMSTLNDTDKIRDVCNVFDGYGKMFDNLERDSDGMITLEDRFLMMEAKKNV
QTFLQQYHFGIFYSFIKLKQLEVRNIVWISECIAQRQTDRINAFIPIPLD
Download sequence
Identical sequences Q9VCQ3
FBpp0083793 FBpp0083793 7227.FBpp0083793 NP_651128.1.81976 FBpp0083793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]