SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VD28 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VD28
Domain Number 1 Region: 41-330
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.11e-60
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9VD28
Sequence length 408
Comment (sp|Q9VD28|JMJD6_DROME) Bifunctional arginine demethylase and lysyl-hydroxylase PSR KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=PSR; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSEEFKLPKRSRKRTREVKRKARPELDGENAWSAMRYCEKFEPFWDFTDNLERIEESQVP
ESEFIERFERPYKPVVIRGCTDGWLALEKWTLARLAKKYRNQKFKCGEDNEGYSVKMKMK
YYVEYMQSTRDDSPLYIFDSSFGEHHRRRKLLDDYVVPKYFRDDLFQYCGENRRPPYRWF
VMGPARSGTGIHIDPLGTSAWNTLIRGHKRWCLFPTQTPKELLKVTSAMGGKQRDEAITW
FSTIYPRTQLPSWPEQYRPIEVLQGAGETVFVPGGWWHVVLNMDDTIAITQNFSSQTNFP
CVWHKTVRGRPKLSRKWLRVLRDQRPELAQIADSINLNESTGFASDSSSNSSSSSSSSSS
SSEEEESDDGGDSNTDSGQESLTAKKKKKRRMAGGGSGSGSMGGSSRS
Download sequence
Identical sequences Q9VD28
7227.FBpp0083632 FBpp0083632 FBpp0083632 NP_651026.1.81976 FBpp0083632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]