SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VDK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VDK5
Domain Number 1 Region: 953-1073
Classification Level Classification E-value
Superfamily Bromodomain 9.55e-22
Family Bromodomain 0.00075
Further Details:      
 
Domain Number 2 Region: 236-292
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000618
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Domain Number 3 Region: 888-948
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000132
Family PHD domain 0.0055
Further Details:      
 
Domain Number 4 Region: 82-133
Classification Level Classification E-value
Superfamily RING/U-box 0.00000883
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  Q9VDK5
Domain Number - Region: 184-227
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0671
Family B-box zinc-binding domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9VDK5
Sequence length 1133
Comment (tr|Q9VDK5|Q9VDK5_DROME) Bonus, isoform A {ECO:0000313|EMBL:AAF55786.2} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG5206 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MDMDLEQLKNDFLPLIAGIKQEQLDAVPTDALPQMSTPNTASGAPTTSSLSSSSLSLSNP
CDSAEKRSESNSSASAKFTLFKCVYCAQLLGSNDRPKLLECLHVACAQCVSTKFSELDRS
LPPLIHCPVCDNASQQEFIVDNQFLIEQCTAGDSGDGVGLLGLTGEGQKSSAAASIQCSS
CSDGAVATSWCVDCSEYICDSCVQAHQRLKITKDHTIKPKDEANNEQLAGAAGVDKLHMC
QLHPQEKLSLFCETCDKLTCRDCQLSDHRDHKYKFAHEIATESRQALSTLVSEINYKRFL
LSSATKVIDDRQQLIHDKKKDLIKEITAMAVKITNTVNTRGKQLIMRLNEVCDSKLKVLV
EKKETLQLLSDNTDHCIDFMQNALEKGSDFAILSSKKSLVRHLQKLKCQRADIPNPEIPV
RIQVQLNQVSDLQKVISQLGIIIVDGKPYPPTPSPNGTPQPQHPPRQPPSPNMAPPLRPG
LPPGMPAGLSPNGPPVNFGPQNGPPLYSNAAQQQFNNLSMSRSFPGDGSGKVRFGGMPPV
GMQRHGQPHVSSSTHPQNMDISLRGLLNNQAAQSPNAHMAFNGPPSYPGGPQGAPAPAHQ
PMGPQMRPHFMPGQQGFSQGGGPGGGPRDANFMNSNARFQSQYQRMANHAQQAAAAAAMA
GAAGGGGGQIPSPGALQRPQMMSNPMQNVSAMQNSLGFHGSQAGFNTGPPQTSPQLGGGG
MHSLAKWHIPQSAQQSNMCSQQGPLLPFANGRQTSENFKISLKSPNTLKNSTPPSLGGGG
AGHQGHGNGSSSAQLNAAALGLGPAVSILSNVTSTNPKTPSPSTHENTKDFTEPIDKVRD
DSINDLIATIAKLDSNGVQVLPEGRTKTTSPQVHSSTDLSNTQEVNNKNEQKDDPNEDWC
AVCLDGGELMCCDKCPKVFHQNCHIPAISSLPDESESWQCLLCVNIKELTKTEGSEKSSS
GELSALELRILQRICLELYCQYEQSLNFREPESPANTSYYEIVSSPMSLDVIRTRLDPSS
PNHYKDIAGFVSDVRLIFSNTYLFYQEDTKTYSNAKYLENFFEEQLAKWLPQFEGTKPQG
KRNTSNSPALLGVNATGSPSPIENGRKSCGSASLGDSDGACLPAKRARRSAHE
Download sequence
Identical sequences Q9VDK5
FBpp0083320 7227.FBpp0083320 FBpp0289844 FBpp0083320 NP_524724.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]