SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VDQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VDQ7
Domain Number 1 Region: 24-151
Classification Level Classification E-value
Superfamily TPR-like 6.75e-16
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9VDQ7
Sequence length 948
Comment (sp|Q9VDQ7|NAA25_DROME) N-terminal acetyltransferase B complex subunit NAA25 homolog KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=psidin OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MAQQQGMDSALFERRLRPVYDNLEVGNNRKALQESEKLLRKHPNLLCARALKGLSLLRLG
RYDESHGCLQTVAEEKPTDDSTLQVLSFCYREMEQLDKIVELYQHAVKQNPGNEELLAHL
FISHVRVEDYKAQQAVALQLYKAQPKNAYYFWSVISVVFQGIRGPESALPEKRKIYLGLA
QRMVDKHIKEGKMETEQEAFLYLHILKLQNKYQEAWEFLTGELCAKLYPGAPVSMKFELL
KELGNWRELNELLQQLLDADRDRWDFYKEYIQSSFELLKLTPQGVENGDKDSLARCQEFL
QRIIDSSERKKRGPYLARLELHQRMRAEQLPAEKLIGDFDEMVIEYFRLFGDKSCCTHDI
ALFLPSISMNQRQALASKLLLESGVTSTSLPKNKEQLQKHLCALQISRMCGSHMDLPADH
LLAFYTALKLHYEHGRTTFGKKLLATEMGPSDAYALLAANVMYDLSRRENKSDHLFEALC
LLQYVLRNSTSNFHVKLLSLKIYHLFGCQVGAQEMYEYLDIKQIQLDSMGYVHCQLLALG
GRFSGNRNVYDATLKFFTNSYKERLEYIALTYRFCTFSKMEEFMNFKERLTNSLQYVACS
VEAQICDLVSCYGNITQNLSAYVAMSIEPAEDRIAWHELSDNRDLGAIIRWDPLHEVDAA
EERRESFDQEVEVLQVRSLMLRLFASFIDLYHGAGLKDSPAGAETATLELLRESWTGLFQ
RLRVMNYKPLAQKFLVNLLPTRLHLLLDMPYERFFDDLAQLVLDLQSGSAKLAEQCKRVG
DNVIATMELCVQTINESNESNGIDGLWKRRGQQQKVAASLEMLSLYAFLLSVLNDKLQVS
SKTKTKKKPVENKVDGPQPISEKERSQMLQELMRQLKHKFEACDTAIRSWKAPVLPRDLS
SFMSDMSLKPEVEATLIGDVSATFKDSHELMVTELRNLLKDKIRMVAK
Download sequence
Identical sequences Q9VDQ7 U3Q053
FR704 NP_650858.1.81976 FBpp0083238 FBpp0083238 FBpp0083238 7227.FBpp0083238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]