SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VEA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VEA2
Domain Number 1 Region: 19-88,147-238
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000843
Family WD40-repeat 0.031
Further Details:      
 
Weak hits

Sequence:  Q9VEA2
Domain Number - Region: 836-871
Classification Level Classification E-value
Superfamily RING/U-box 0.0565
Family RING finger domain, C3HC4 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9VEA2
Sequence length 876
Comment (tr|Q9VEA2|Q9VEA2_DROME) Vacuolar protein sorting 39 {ECO:0000313|EMBL:AAF55525.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG7146 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MHQAYSVHSILKQGVQIESIAAYGNHVILGTRSGQLIMYSVDEETGVDMRMFNKNFSRKP
ITQMEVIASENLLFVLTDLQVQVCDIRRIESNFAFMHSAPDTKGCTLFTMDVDTPKSTTG
RVATVIRVCCAIRRRLVFFFWKEDKLNSLELIIELSDVPRTLCWVGHAVCVGFKDEYVVY
DISGKAPKKHNLFLTSSSISRDPCICLIRNNMLGISKDSYLVVVDPSQYKESDGINNSTD
VRPAAMDSNSSLTPLLWSSPLLDLVWDEPFAVGRVNNAIEVRSLVGKDTLVQTIPELQKT
KFLVHADKGTIFAAATSELWCIRMVEIPIQRQQLLQQKKFQLAIELTQISDEPAADRAQT
IRQIHMLYAKELFTNKEFSAAMKEFEKAAIDPYDVIRLFPNLVPEPKPGTEDVTVPTSST
PALEDSDLENAYLALIEYLAWARQREVVKLRDTKSSSKSLLEIIDTTLLKCYLQTNDSLV
APLLRLNQCHLEESEKTLKKHNKISELIILYQMKGKHKEALKLLREQASIEGSVLQGRKR
TIRYLQELGGDHLPLIFEFADWVLNDNPEEGLTIFTDELIEVESLPRAKVLDFFISKHKA
LVIPYLEHVITEWKDGNTLLHNVLLKQYREKVQRLLAQQEKGEEVPELIPMRAKLYKMLE
ESNDYSPDRLLEEFPTNILLEERALILGRLKKHDNVLSIYIHVLGDVAKATAYAEAHYKE
DKHIFHTLIKCILIPPTQPLYDGVPLHPDFSQVNREVALEILNTHATRIDPFEIFEHLPD
DMPMPQLEKYLEKSIRKMMADKHEMQMMCGFLEAESTRLENALEEQRNISFELNESSVCS
ECKKRFQTQSAFVRYPNGHIVHLSCHDRLARAAAQQ
Download sequence
Identical sequences Q9VEA2
7227.FBpp0083022 FBpp0083022 FBpp0083022 FBpp0083022 NP_650702.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]