SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VEQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VEQ2
Domain Number 1 Region: 62-228
Classification Level Classification E-value
Superfamily TPR-like 3.21e-18
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VEQ2
Sequence length 282
Comment (tr|Q9VEQ2|Q9VEQ2_DROME) GH23451p {ECO:0000313|EMBL:ADC54210.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG3678 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSLDYEKMSWSDVRDQFRTWREETGRHSEEVVQLWVAVLEDKVHKTGNERHLILEQVIIA
ALDTARFDIATKCTKQLALEFPGSLRVMKFKAMRYEALEQYDEADEVLDAIIAKDETNAA
PRKRKIAILKARGRRLEAIKELNEYLKKFMSDQEAWHELCNMYLAEGEFGKAAFCMEEVL
LHNPHSHLIHQRLAEIRYTMGGVENMESARTYYSQALKLNPHNLRALYGIYLCCNHLDNS
RAVSSKRKELQKLSQWALEQLLTKQTIVPLEAAFGNLEIKSN
Download sequence
Identical sequences Q9VEQ2
FBpp0082819 FR684 FBpp0082819 NP_001262651.1.81976 NP_650580.1.81976 7227.FBpp0082819 FBpp0082819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]