SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VEV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VEV3
Domain Number 1 Region: 87-222
Classification Level Classification E-value
Superfamily TPR-like 9.25e-28
Family Tetratricopeptide repeat (TPR) 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VEV3
Sequence length 263
Comment (tr|Q9VEV3|Q9VEV3_DROME) LP07287p {ECO:0000313|EMBL:AAX33517.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG14894 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MAGNANSDDEFHDAIGEEITEKEATSTRQSEKDVDEIVEKQNQLALDDEAEQGAAGGDSI
ATPTTVDSELTIEELREREKDLSPEQLTANKEKADKLKVEGNELFKNDDAEGAAKTYTEA
LDICPSASSKERAVLYGNRAAAKIKLEANKAAIDDCTKAIELWPEYVRVLLRRAKLYEQE
DKPDEALEDYKKVTEIDPGQQEAREAQIRLPPIINERNEKLKNEMMSSLKDLGNMILKPF
GLSTQNFQMQQDPNTGSYSINFK
Download sequence
Identical sequences Q9VEV3
FBpp0082765 FBpp0082765 NP_001262636.1.81976 NP_650543.1.81976 7227.FBpp0082765 FBpp0082765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]