SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VF81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VF81
Domain Number 1 Region: 430-703
Classification Level Classification E-value
Superfamily TPR-like 1.21e-43
Family Tetratricopeptide repeat (TPR) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VF81
Sequence length 705
Comment (sp|Q9VF81|TMTC4_DROME) Transmembrane and TPR repeat-containing protein CG5038 KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG5038; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MLDLVHKATLHSMVCQAILVLICLLCYGCGGLSGAKFVFDDTVAIVKNRDVNSLPTNWTA
IFTHDFWGASLLSSDSHKSFRPLTTLMFHCEYALLGLSAAHMKFLNLLLHCVNTLLMWRL
IRSLYVPEVSTARWAILSAALFAAHPIHTEAVSGVVGRAELMFGMIHLLCLLLTVANTGR
LGPQTGGLIMLLTAVGMLFKESAVTIPMSCVLLDYFQNGYYHLRFKDQWSLLRTRISYLF
YLLGTLGLLTARLWWQDFETPTFKEVDNPVAHNEHVLTRGLSQQYLLVMNIWLMLCPHWL
CYDWALGCVKLVTNIWDLRLQGVIGFYSIVLVALMNFRRLPGMMLALGLMIVPFLPASGI
ICVGFVIAERTLYVPSIGFCLLSIYGFLYWYDSSTENTHWRTALRILLMLLFSVMMVRTR
QRATDWLNEEQLFKSALQVCPDNAKVHYNIARLATDMGNNTKAFQHYHRAIELYPNYESA
LMNLGNLYREHGQLSTAEEYIRLALQAYPAFPAAWMNLGIVQSAQGKYDKALASYEKALK
YRANFAVCYYNMGNLYLEQKRYAEALHHWQHAVALNPRQPKAWANILTMLDNKGLQDDAL
RISNQALQHLPNDVSILFIRANVLGKLKHYTEAEAIYKRVIELEPHNTLYHTNLGVLYHR
WDKTQEAIEAYRTAISISAARATTARENLSKLLKRLEREAQVMQR
Download sequence
Identical sequences Q9VF81
FBpp0082545 FBpp0082545 FBpp0082545 NP_650451.1.81976 7227.FBpp0082545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]