SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VFC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VFC4
Domain Number 1 Region: 60-256
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-35
Family SPRY domain 0.013
Further Details:      
 
Domain Number 2 Region: 1260-1309
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000326
Family RING finger domain, C3HC4 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VFC4
Sequence length 1332
Comment (tr|Q9VFC4|Q9VFC4_DROME) CG6752, isoform B {ECO:0000313|EMBL:AFH06434.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG6752 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSISKLFVKVFNEDIFEQVDHDNLYSDLDDDLEGANCSTVPDPRPAKLADLSVTKQMLIV
RTWLDDKFQQIQTDSNEEIRRLYMETESRIGPDLTIFDVDYTTTVRVSSDRLALRSQGSF
NTVRANCCVYGGRWMYEIHLHTKGVMQIGWASNSCQFNENSGVGDTKSSYGYDGSKQQIW
HISTKKYGDKWQIGDVIGVTIDVDKEVIEYYRNGRSMGVAFNKLEKGPGISFFAAISLGY
TQGIEANFGNRPFMYPVSGFQPLMARPILKLQRANLLMNYLVNLAGIFSKYNAQSGMAPT
NGADARVSTKKTVYCIFATLLIEKFTNEIFDPYIIEDVLLRKISSMTNLASEKENSYSVL
HGLLSLFWNYMEGDEIKFVLRKLVNALLGTFTHTIQGLDYEKHRQALGMLHCLCLHEQTR
KYLLEGKLFKKHCLAFFLYIHPLEFYIMEELLPDSMAWTEGIDGPKEKYLNVVEKVRKVT
EPLYTAQKDLLCTLMINSDGSRESPSSRSIFLSKLRRYVIDLSMEQRPFHAFFFMQSSIQ
HPLDAPVALAFASILIDQTRSMFKDEMPTKNVEVNSDYFIDGTFDYMHFDRVGGVLSHLR
KVHRGDIDARLGSARTQQIYEDDRQNLRVNEVDTTLYLLGENINNVPVVGHTQGANNTTY
THFLNTRPNSSTDSSPGNADMEASLCELLDLCIIFYYSAGHKYIVKIATVRDEIAALNEV
LKETKFYREDIERKLGALEQHANVCMNENHQHVMGELRSKFSQRQNVFATRSIALARKQV
WLRGVALNNHRRSLLIWLLERMLRTLTTASNTGSLFSFVPEVYVNTLPILLDAVMDFSHH
DLKAQFEASDAECSVNAAAEFLGIHSADPRIVLASCKDSLLQALGTLTCHKSGVRALERT
SKRSQASLVRALLRPYENRAWGQSNWLLLRFWMGEGYAYKDSRQPSVWQGGSLPLHQGLC
RSRSRNETHTGLLHNVAPANPSKHFQRLIGAKLLEDEPFATAFLNSVLSQLNWAFSEFIL
LLQEIQNTAQRQENTLFEPKQLKICSMCFELTVSLMRCLEMVITTAPEIVTDESRPNSDL
LLNRICQLISQVLSRVTVPPGCFQFVVDMCSADLNAVTHYPIVTAALGILLALMQEEMES
DLRPQIVTRVSRAFLTDPSFQFATLEFALGEIRTPLLEQKNIPRGNFDPSSRPHIDPLTN
DVRVPLPNNSKRIRADPPILKFALNDFPSHVSSEEIDNVRRLIDSLRVKQTLLSDITLPS
EDSLCPICCAKPITAVFTPCKHQSCSDCIMQHMMNSKVCFYCKTTIQTIETLDGTVIFSN
DDVVQTPMIERA
Download sequence
Identical sequences Q9VFC4
NP_001247116.1.81976 NP_650425.1.81976 FBpp0082488 7227.FBpp0082488 FBpp0082488 FBpp0297356 FBpp0082488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]