SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VGH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VGH2
Domain Number 1 Region: 49-312
Classification Level Classification E-value
Superfamily L domain-like 6.46e-30
Family Ngr ectodomain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9VGH2
Sequence length 425
Comment (tr|Q9VGH2|Q9VGH2_DROME) CG6959, isoform C {ECO:0000313|EMBL:ACL83496.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG6959 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MILVVAIAAIILAIGAGGVLGENSSSCGPNFPAACSCGQEMYESEMQYVVNCTNAGLVNT
SVLEFMPEQVEVLIFTGNRITELPWNVFGSINNYKQLRIVDMSSNHIREIRGKSYHHVPR
VERLILNHNNLSISRYEDEVNHHHPRVFSNFINLQSLHLTDAFEDNSSPQLSEDLHDIFV
NSQLVKLQKLHLEQNEITHFKDRNVFCDLPSLRDLHLGDNDLRDLNFEVRCLNNLRFLDL
ERNKFSFVKPTDLRVLNELEERPNRTANLIVDFNLNPFGCDCRTAPFRAWITTTRVTVRN
KDSLMCFHSTGHVDAEPAHLLQMDMGQCADAIAAAATILNTAEDEPHYGDPEASHLQPQA
HISGHTATLIFLLIVLTMILLGLLVALVYVSRDKLKYMITPVFDNVAKKVQYTSIKDEDC
PEVHV
Download sequence
Identical sequences Q9VGH2
FBpp0081991 NP_001138037.1.81976 NP_650122.1.81976 FBpp0081991 FBpp0288869 7227.FBpp0081991 FBpp0081991 FBpp0288869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]