SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VHV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VHV3
Domain Number 1 Region: 54-416
Classification Level Classification E-value
Superfamily L domain-like 9.86e-44
Family Polygalacturonase inhibiting protein PGIP 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9VHV3
Sequence length 533
Comment (tr|Q9VHV3|Q9VHV3_DROME) FI02011p {ECO:0000313|EMBL:ACJ13134.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG7800 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MYLIIIALLASVSALGRPDLEDYCNDSYCHLLGRSRTFSDKKATKLTEFHMDSCEKKVLK
LMPNLRTLELENCDSPDFTMNDLNQLPYLTSLQLRRGNLLGLHDEHFSKWPNMKILMLGG
NNITRLSNECFKGLAQLWLLSLPGNGIQGLPWDVFQNLPELLHLDLSGNRIETLHENIFT
GVPKLEMLLLNGNPLTWIAPTSLKSLSNLRLLDMSNCGPLPDLSLPGAHTLILDNSGVQR
LDILGSVHKLQARKNHITEIKLPDKSSVIELDLHSNLLTATDIPKLLTGMWRLQRLDLSE
NIIGIYAAAGSDNTSELFILPNLMYMNLSANRLTRLHFDSPIPWERLTHLDASYNRIYAP
AKVGIDEAFNLQSLHLEGNYINNFELTPWKPHPSLKEVALYDNKFQPKGYKNITKFFNEI
GVNVLEKTQYSQSNNTTPTCKPCIPDARDFPTSISADTNQTIDTKVNPLSNDTYQWNVWN
VLMLVSLIVSLFVNSFLIVKLIRLRGRNQFTQSSSVPAIIEMFSNESDDEIIL
Download sequence
Identical sequences Q9VHV3
NP_649770.1.81976 FBpp0081291 7227.FBpp0081291 FBpp0081291 FBpp0081291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]