SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VIA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VIA4
Domain Number 1 Region: 815-961
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.57e-31
Family Toll/Interleukin receptor TIR domain 0.00055
Further Details:      
 
Domain Number 2 Region: 122-420,566-633
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000051
Family Ngr ectodomain-like 0.04
Further Details:      
 
Domain Number 3 Region: 688-757
Classification Level Classification E-value
Superfamily L domain-like 0.00000102
Family Ngr ectodomain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9VIA4
Sequence length 965
Comment (tr|Q9VIA4|Q9VIA4_DROME) MstProx {ECO:0000313|EMBL:AAF54021.3} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG1149 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MKLLLTIPDDYCETYCGGICNDTVASKTCDREAYDYIATNEYHLIMRDGHLEVNWKIPDP
NIFIISPISKENRLKLNELIVSDTSYPIRAVDYLRQLGVETVTRFENQINSFKVIERDVH
YINGPKSLKIIIQSNLYLNEIIEYINKTTDNVNEIIINAYKTVENQQIALDNLIFNGKSH
LRSLTFIGFQIENLSTKPFAQFINLKRMVLTNCTVRNLTFLRTLQKSLEHLELDIDNEVD
LKYFTNFSSLKFMKVRNYIPNKNFTALICTHKNCNFIRGINGLECPKLCQCLYIIDDLEL
NIDCSNLGLLQIPPLPIPSYGGVKLNFSNNSLSQLPTMTLPGYKLVKRLDVSRNRLTNLS
INHLPAKLDYLDVSFNEIINMGNDVIKYLRTVPIFKQTGNQWTIHCDDKPLLNFFRHLKL
IIRMKSAEMKPMFLHSLTELPKGFLKFLGKHFIWLGVRKQEYYLINEEQLLQSMHRKLNN
LNTIMSIYKYMEWLHRKLIFVNREYDLFYIRQMAAPCPHKCECCYSRDSLILKIDCRNKF
VYNFPDIVARNSRLMGKQNMSSPMELHLSKNNISNITIAMLPKELRFLDLRFNNLVTLDD
KVLSYLKKNSIKTKLSGNPWNCDCKSRSVLSILRDHEPLEYDVTLKRCNISPTDCPDVCV
CCLDNLTWPSFIVDCRGEGLLQMPSLSSRVTYVDLRNNNLTALSQKNRSSIENRSLKLHL
LDNPWSCSCNDIEKINFMKSVSSSIVDFTEIKCSNGEKLVSINQHIVCPSDLFYYLALAI
SLVATIIALNFLIWFRQPVLVWFYEHGVCLSLSAKRELDKDKRFDAFLAFTHKDEALLEE
FVDRLERGRPRFQLCFYLRDWLAGESIPDCIGQSIKDSRRIIVLMTENFMNSTWGRLEFR
LALHATSRDRCKRLIVVLYPNVKNFDSLDSELRTYMAFNTYLERSHPNFWNKLIYSMPLL
PSYVD
Download sequence
Identical sequences Q9VIA4
FBpp0081104 NP_649719.2.81976 FBpp0081104 FBpp0081104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]