SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VIH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VIH1
Domain Number 1 Region: 27-144
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.37e-24
Family Single strand DNA-binding domain, SSB 0.00076
Further Details:      
 
Domain Number 2 Region: 181-245
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.56e-16
Family C-terminal domain of RPA32 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VIH1
Sequence length 246
Comment (tr|Q9VIH1|Q9VIH1_DROME) Replication protein A2, isoform B {ECO:0000313|EMBL:AGB93187.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG9273 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MNDSFGDFNATQTAPTGAASNQKGEGIVPLVVKQIVDAPEGNIELFGMQYAMACVVAIVR
NVETSSTKITYTLEDHSGRIDAHYWLEEGDALKAPEVMVNNYVKVYGTTRSQGGSKTLMI
FKLLPVLDPNEVCTHLLEVLNARYRAEDYQSKGGAGAGAGASSGSGSIADFTASQSSAIV
SGLEPKQQAVFQAIKSNVSEEGISRKELKAKFSHISDSELTNILDFMISEGHIYSSIDAD
HFICTM
Download sequence
Identical sequences Q9VIH1
FBpp0080967 FBpp0305226 FBpp0080967 FBpp0080967 NP_001260652.1.81976 NP_610077.1.81976 7227.FBpp0080967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]