SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VJE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VJE3
Domain Number 1 Region: 134-207
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000422
Family PHD domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9VJE3
Sequence length 404
Comment (tr|Q9VJE3|Q9VJE3_DROME) LD24839p {ECO:0000313|EMBL:AAK93136.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG15141 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSESNATDGVHEVEESNPLEQSTITMLDVLEQEKELEDEYAAVLGASDEKSCTYAKGPIG
RQALYSCLTCCPEAREDLDKAAGVCLACSYRCHEHHELVELYTKRNFRCDCPTQRLGKCS
LNPQVEGVQPRNVGNLYNQNFQGLYCKCKRPYPDPDRTVEEVMLQCAICEDWFHLPHMKA
PGASDKWLDVCSEMICDGCMDAKPFLKDYTGLALQPVLEDAKEDKPEADDSQLKNELDRS
ICDIMKVPEGESQPDEGEPSQKRAKLDDCRRPKPTKEHQGAAFWTNDWRKSLCQCSECLS
LYKELAVEFLLDVEDSAKTYEERGMKRAEENSSYEQGIRALASIDRTQQIDAITEYNRMK
DKLKEYLQAFAASKKVVTEEDINRFFAGMRNENNANLGQPYFCR
Download sequence
Identical sequences Q9VJE3
7227.FBpp0080532 NP_609837.1.81976 FBpp0080532 FBpp0080532 FBpp0080532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]