SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VJE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VJE6
Domain Number 1 Region: 55-281
Classification Level Classification E-value
Superfamily L domain-like 1.64e-35
Family Leucine rich effector protein YopM 0.05
Further Details:      
 
Domain Number 2 Region: 662-756
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.3e-21
Family Calponin-homology domain, CH-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VJE6
Sequence length 1135
Comment (tr|Q9VJE6|Q9VJE6_DROME) Leucine-rich-repeats and calponin homology domain protein, isoform B {ECO:0000313|EMBL:AAF53603.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG6860 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MAATVYQRLHSVAVGVGSAAGSAIGSGSASLPGSGTGSGSGIGHAGNTSSSTSSALLSHS
QLTRSLERILEEAHFSGELILTNRKLKDFPRTGTKYSLTDTVIADLSRNRFAELPEEVTT
FAFLETLLLYHNTIRSIPESVKQLSSLTYLDLRSNQLSSLPREICFLPLQVLLVSNNRLT
SLPDELGRLDQTLTDLDASYNQLANLPARLGELRSLRSLSLRSNHLLYLPRELTCLSLIS
LDVSNNKIASLPLEIRHMSTLVELQLENNPLTSPPASLCMRGLVHVFKFLETQATKDEKG
SRSGGNYDGYTTLRRAPRHNSSGNVLEASTTGSTNNQRRHQVDSGYNTSDGLDKRWSHDA
PTKSKTDSPLHCVSNSTAATLPRTLPSAVHSQADLMDASLTSSTSTIVDESLTLSPTASP
CKLSYAHSNSSSNGSSPDQDDDIMLDHQERTVHHANGRSGKGLGNIQTYKEYKEALKQQR
NQEISVYKQKHPNANHSPNDDEDLSPSPPSISNGSSSNTLPKSIMKQNSNQIGHNGNGNG
SANGNGVDDVVIPKKPIQKVIPSRITEIKPASTSDIRSANSSDCLGYVKPQSPMKNGTSK
FNTSNGGGVQTTVGIVSSTTIKSPVSSTTKLGTVKTHRSVTWNHDIPAEKLSFTMRREFD
RQREETELMSQLRTIIETRLKMTLPVDIASALTDGVILCHLANYVRPRSVASIHVPSPGV
NKLTMARCRRNVDNFLEACRRIGVDEELICSCEDVVPQIEPQQPQLPRADDDYDADVYVQ
DDGSISRSNDSSHLQCSDDCNSSSNHINRVPNALALLRTVSALIAMDENPYHQQLHHHLQ
LQLEQQHFEQEQFSEPTTCSQQQEQMLLLQQQQQQLEHVLYENGLPRAENDDGVEDRDDD
IGKRQQQLATVGQMLLKAKQKTYEKIKHNLLSAHGQHNFQGNNNNRMLHTIVENEHDVAA
AGPAGHYQIIDEKQEEDPYQPKSEDLKDAAALGNATKEAISKRIEFFEQQKSGKPKLEVF
SIYLPKEKTKELELEQKIKAKTNEAGSSILKHDSHTLTVILSCVFIATFLWLNLICCAAD
VLEGKGAVQVAITVGELFRLHGNGGCGSGNSSGAATPTKSPTRTTRATMSPTPLA
Download sequence
Identical sequences Q9VJE6
FBpp0080522 NP_609834.2.81976 FBpp0080522 7227.FBpp0080522 FBpp0080522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]