SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VJH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VJH2
Domain Number 1 Region: 522-713,805-957
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.89e-88
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000189
Further Details:      
 
Domain Number 2 Region: 405-506
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.81e-20
Family Anticodon-binding domain 0.0015
Further Details:      
 
Domain Number 3 Region: 234-330
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.63e-16
Family Anticodon-binding domain 0.0025
Further Details:      
 
Domain Number 4 Region: 90-184
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000416
Family Anticodon-binding domain 0.0041
Further Details:      
 
Domain Number 5 Region: 692-810
Classification Level Classification E-value
Superfamily GAD domain-like 0.00000000283
Family GAD domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9VJH2
Sequence length 1082
Comment (tr|Q9VJH2|Q9VJH2_DROME) SD02215p {ECO:0000313|EMBL:AAM51040.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG31739 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSGRYRGGGGGRFGGRGGGGYADGGGYNDFDNYRGGGGPGFNDNFGPGPGPNPFNMGGPN
ISGNELMQLMSAMASNFNMNSQPPQPMRQSCGELRNHHCGLFVELSGRLIKKRVNRFAEL
RDRNGGACQLVVLEDKHPRVARRMNNMPENTTLTIVGLVMRRPHNSCNQTMPTGEIEVEV
QDILNIHFPAGGTKRAGDKRTYSTMVQQQSNLGITSTEYKIAKNENILKYFENRDLTCND
LRRDDVGKTVTLVGWIPSTKNNKFLQLKDGYGQTQLMIEDQSLSDTFLSTPEQTVIQIVG
KVLGRPKANVNLKYDTGEVEVSVTSVKVLNPDDPYDGPIKAKEKKQKFSIDDLEAEEAAA
EASANLTSNNGESTEDSAEASTTANASLIAEQRAKVADTNKFADRTHNCGELTSNDINEK
VVICGWLEFQRMNKFFILRDAYGQTQVLLSPKTYGLEEYAETGVPIESIVRVEGTVIPRP
AATINPKMQTGHVEVEADKVVVLNPAKKNLPFEIRKFNRAGERLRLTHRYLDLRFNDMQH
NLRLRSAVIMKMREYLINYLGFVEVETPTLFRRTPGGAQEFVVPTRKAGHFYSLVQSPQQ
FKQMLMSGGIDRYFQVARCYRDEATRPDRQPEFTQLDIELSFTSRDDIMQLIEETLRYSW
PKDFPRLQTPFRRITYEEAMEKYGNDKPDTRFGFLLNNVSEIIEKSDEFKEKYDDLGAYA
IVVRASEAFWNGAARKHYESLGKEFKGTLFVRKFGPTKDVQEKLGKLLGEDVATEVADKF
DLEENDLLFLGIGSKVETRELLGRIRLDYQDFLVENAKIKKPNDFRFLWVIDFPLFERNR
ETNQLESVHHPFTLPHSDDLENFATSCENLESIRSQAYDLVLNGQEVGGGSIRIHDRDMQ
HFILEQILKIPHDHLSHLLSALESGCPPHGGIALGLDRLIAILCRARSIRDVIAFPKSLN
GRDPLSNAPVPISDEEMRLYHLSVVDEEEPSTNNTSHEQEDDDPDQERAPPSPMSATSES
EQPQINVDIKQEPEGLNEDFAPESPATKSTVKADPDEPSPSNPLASEAATPARARRTVKK
KV
Download sequence
Identical sequences Q9VJH2
FBpp0080475 7227.FBpp0080475 FBpp0080475 FBpp0080475 FBpp0304012 FBpp0304013 NP_001260519.1.81976 NP_001260520.1.81976 NP_724018.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]