SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VJV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VJV8
Domain Number 1 Region: 246-360
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.8e-20
Family Anticodon-binding domain of Class II aaRS 0.00082
Further Details:      
 
Weak hits

Sequence:  Q9VJV8
Domain Number - Region: 126-259
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.00721
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VJV8
Sequence length 361
Comment (tr|Q9VJV8|Q9VJV8_DROME) GH14674p2 {ECO:0000313|EMBL:AAK92915.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG33650 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSRIQRCFKSLASAGFFRTVEDNKLELLSHGREYAKLLQQHWTRLRPLAAHLGATKEPIN
PVNIQRFSFPQSQQFRNNFQKLVKDHPRKAKCPTLLKHQSTCSGPTSNSLFGIKGPTLHL
TTDFLVEPHRALEHFYNMQRESKIWWMRLSSNPSRYRIVPCDLAEDLNPNDYQAIDIRTS
YGDAGEVTVEQLSLVRIVDDKDFRLPDARTGEIVQPTVIRSVIELETTTCALLLDGCDHG
RDSQSLLLHRVLAPYQCGIACVESDSELSADLSDLCQHLKHVLNHAGLRLSEGDGIRTTK
NASHLAEHLLETDMLGIPYTLVINEQTLRNGLMQLRSRDTRLAETIHISDVPDYLLNIFK
N
Download sequence
Identical sequences Q9VJV8
NP_001027262.1.81976 FBpp0099758 FBpp0099758 7227.FBpp0099758 FBpp0099758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]