SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VJW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VJW1
Domain Number 1 Region: 575-769
Classification Level Classification E-value
Superfamily Sec7 domain 4.45e-70
Family Sec7 domain 0.00000216
Further Details:      
 
Domain Number 2 Region: 91-161,339-540,1005-1392,1543-1635
Classification Level Classification E-value
Superfamily ARM repeat 1.78e-22
Family Plakophilin 1 helical region 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VJW1
Sequence length 1653
Comment (tr|Q9VJW1|Q9VJW1_DROME) Secretory 71 {ECO:0000313|EMBL:AAF53331.2} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG7578 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MHNNSTKTKEMFIVRALEKILADKDIRRSHHSQLKKSCDSALEQIKAELISAGQIAEGNE
LPCAALPLPKNDAASIINAETYFLPFELACKSRSPRIVVTALDCLQKLIAYGHLTGSIQD
SANPGHLLIDRIVVTIYGCFSGPQTDEAVQLQIIKALLTVVTSQHVEIHEFTLLQAVRTC
YDIYLSSKNLVNQTTARATLTQMLNVIFARMENQVYELPPPNSNPTNGSIHSEDCNGSGE
ESLRDSDEVIASELLAEIISAAYNEAMKDQESVGEPEPTLNGNDYSSHSDHDSVELHSEN
DAVVTAKFTHILQKDAFLVFRALCKLSMKPLPDGHPDPKSHELRSKVLSLHLLLLILQNA
GPVFRSNEMFIMAIKQYLCVALSNNGVSLVPEVFELSLSIFVALLSNFKVHLKRQIEVFF
KEIFLNILEANSSSFEHKWMVIQALTRICADAQSVVDIYVNYDCDFSAANLFERLVNDLS
KIAQGRQALELGANPMQEKSMRIRGLECLVSILKCMVEWSKDLYVNPNMPVPPMQVQSPT
STEQDQADTTIQTMHSGSSHSLNSNQEQLQDLPEALEERKMRKEVMETGIELFNRKPQKG
VQFLQEKQLLGATCGDIARWLHEDERLDKTVIGNYIGENDDHSKEVMCAYIDAFDFRQME
VVAALRFLLEGFRLPGEAQKIDRLMEKFASRYCECNPKNQLFQSADTVYVLAFSIIMLTT
DLHSPQVKHKMTKEQYIKMNRGISDSKSDLPEEYLSSIYDEISEHEIKMKNNSGMLQQAK
PTGKQAFITEKRRKLLWNMEMEVISLTATNLMQSVSHVKSPFTSAKHLEHVRPMFKMAWT
PFLAAFSVGLQDCDDPEIATLCLDGIRCAIRIACIFHMSLERDAYVQALARFTLLNANSP
INEMKAKNIDTIKTLIMVAHTDGNYLGSSWLDIVKCISQLELAQLIGTGVRPQFLSGAQT
TLKDSLNPSVKEHIGETSSQSVVVAVDRIFTGSMRLDGDAIVDFVKALCQVSVDELQQQQ
PRMFSLQKIVEISYYNMERIRLQWSRIWQVLGEHFNAVGCNSNEEISFFALDSLRQLSMK
FMEKGEFSNFRFQKDFLRPFEHIMKKNASPAIRDMVVRCIAQMVNSQAHNIRSGWKNIFS
IFHLAAGDNEEPIVELAFQTTGKIIGDLYKRQFAIMVDSFQDAVKCLSEFATARFPDTSM
EAIRLVRTCAQCVHEAPQLFAEHAGMENDASVAEEDRVWVRGWFPMLFSLSCVVNRCKLD
VRTRALTVLFEIVKTYGESFKPHWWKDLFNVIFRIFDNMKLPEHVTEKSEWMTTTCNHAL
YAIIDVFTQYFDVLGHLLLEELFAQLHWCVQQSNEQLARSGTNCLENLVISNGFKFNEST
WDKTCQCILDIFNATLPQDLLSWRPKAHSSNNIPQEHNHFEALHIRCVVQLELIQTMDNI
VFFPATSRKEDAETLAQAAADLTGGRSGSQSQLLECQREEQGMYGYLRTRQLLTLADCLM
QSHRFAKRFNADHDQRSLLWRAGFKGSVKPNLLKQETSSLACVLRIFFKMYGDENRRSDW
PGIEQELVQVCKEALGYYLSLQSEAHRDAWTSLLLLILTRLLKMSDARFATHVSNYYSLL
CEMMCFDLKPELRSVLRRVFMRIGPVFNIMSVK
Download sequence
Identical sequences Q9VJW1
FBpp0080115 FBpp0080114 NP_609675.2.81976 FBpp0080114 7227.FBpp0080114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]