SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VK54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VK54
Domain Number 1 Region: 96-331
Classification Level Classification E-value
Superfamily L domain-like 7.37e-46
Family Ngr ectodomain-like 0.012
Further Details:      
 
Domain Number 2 Region: 328-429
Classification Level Classification E-value
Superfamily Immunoglobulin 3.66e-17
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9VK54
Sequence length 880
Comment (tr|Q9VK54|Q9VK54_DROME) Kekkon-1, isoform C {ECO:0000313|EMBL:ALI30206.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG12283 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MHIREAVFLVLTLLPGMILGTRYNQLHLYANGGASSSGPGGYRPAPSSQNEVYSIADSQP
MTEDGYMPPSQHFPPTHSDLDPPAQQQSTCQTVCACKWKGGKQTVECIDRHLIQIPEHID
PNTQVLDMSGNKLQTLSNEQFIRANLLNLQKLYLRNCKIGEIERETFKGLTNLVELDLSH
NLLVTVPSLALGHIPSLRELTLASNHIHKIESQAFGNTPSLHKLDLSHCDIQTISAQAFG
GLQGLTLLRLNGNKLSELLPKTIETLSRLHGIELHDNPWLCDCRLRDTKLWLMKRNIPYP
VAPVCSGGPERIIDRSFADLHVDEFACRPEMLPISHYVEAAMGENASITCRARAVPAANI
NWYWNGRLLANNSAFTAYQRIHMLEQVEGGFEKRSKLVLTNAQETDSSEFYCVAENRAGM
AEANFTLHVSMRAAGMASLGSGQIVGLSAALVALIVFALGVIMCLLLRVKRQPYVDSKTP
NHMEVITSVNHQNSITNKTQPATGNGSIGGVVIANGAVANIIDGGVVQGGTLERKSSGRG
GVPHGVHDQRSANPVQKPPRLTDLPYSTQGYDNNGSVLSTASCFISPSGSTGNGGNNPDL
INDTKRFGSDEFADLKIPPISGVGVGGSGEYSRANGCDSLYPSGLWEHGAPVGTTSADDL
FMKRYTDKTPIIDSTQLYDLHERTAATDYFSKTFPRSHLQQGMMTGGGGGTSTASTVTTN
LSGGSSSGYPNDYGLPLVPGAEHQHNHQLQMHPLQQLQQQLTSTLNHQKQEGSSTGSSPH
FSSRTLPRLHEGSGGGGSSRSSPTPAVSGGHANQAANPSTSSSSCSILPNGQPINAKTIR
VWQKGGVPVLPPVTALKRALISSSRNSPDEGYQEGCGTDV
Download sequence
Identical sequences Q9VK54
FBpp0304518 NP_001303320.1.81976 NP_523559.3.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]