SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VLX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VLX2
Domain Number 1 Region: 262-377
Classification Level Classification E-value
Superfamily Bromodomain 2.88e-30
Family Bromodomain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9VLX2
Sequence length 861
Comment (tr|Q9VLX2|Q9VLX2_DROME) LD22651p {ECO:0000313|EMBL:AAL39649.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG7154 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MGSSKKHKKNKSERREKYEEYSQHQDPAQLQRGLKLILKVGSNATPEYSANSPMVDGGPP
TAAEAMMSPVPEELQDHQGHRERHKKSKKKKKKKDREKKHKHHKEKRHRSRDRHRDAGSD
EDMMAGADDAACSGFAPSSVAPPAADPDSSQDGFSFMDDDQSQPLPENILFFAGITTDNS
PSNCPVTKPIAPRKLDDILMGSSPNSSSLQSSSLGLIGSSPTKPLPDLLIPSPSTPGGAN
SLNALTPKALEAPKTPSSSSESGREPRSCVLKLKQQKSPLNKLLEHLLRFLEKRDPHQFF
AWPVTDDMAPGYSSIISRPMDFSTMRQKIDDHEYTALTEFTDDFKLMCENAIKYNHVDTV
YNKAAKRLLQVGMKHLQPENLMRSLKPLSGYMRELTARELGFELSSNDMSRENNDSADEG
ASTGAEEPRTPAQLEEEERKRTLRLENAPKTHFEPYVDDLTGEEILAQVQNAAQQAKQRV
NAKKNAHKMGFLRQMKDGTTTLNLVIKEENEGPERVVTIGDLVGKLQKGSAQLQTRQVDK
RNAVRTVKSLNYGAFASFAPTFDSRFSTLSAEETQLVLRTYGDASSAEYAESILQFTKDS
NYGTTIANGLLDILTNGEHSKSLDELYNMQLHSYEQREIEKCFEQEEETSSQQETTAQIE
QEYEKYKNTHVDFKGLQSLGELGIDVSFLDGMEAEMKSYELNRRMHEHLSQNLTLIEKLR
VAQHDRLSQPLPNHLGLVQPAGQEEIQTAQQLTQQISDLAKKLPPSAIADPYALRKAMGM
SYAGLPPPRPVSPRVQLPELLQQPVALPQLQPVAMEIDESDEQHGGGDLENELREFLESG
SGLHSANPADDNSIVAQLLLN
Download sequence
Identical sequences Q9VLX2
FBpp0079111 7227.FBpp0079111 FBpp0079111 FBpp0079111 NP_609148.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]