SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VN27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VN27
Domain Number 1 Region: 9-219
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.84e-57
Family LplA-like 0.0000581
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VN27
Sequence length 234
Comment (sp|Q9VN27|LIPT2_DROME) Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG9804; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MPFVRPLVTVVRAGRHSYSAGLQLQQRLARSNQILNPPAEFRNYLVLQEHDPVYTVGLRT
KDYTAQDEDRLRRLGADFHRTDRGGLITFHGPGQLVAYPILHLGQFVPSIRWYVATLERM
VVEACHQMGISSAKATKDTGIWVGDNKICAIGIHGSRYVTTHGIGLNCCTDLQWFEHIVP
CGIEGKGVTSLSKELDRHFPVEEASGALLNSFAKVFECRLQEHAKKPASSAEIG
Download sequence
Identical sequences A0A126GUP4 Q9VN27
FBpp0078583 FR154 FBpp0078583 7227.FBpp0078583 FBpp0078583 NP_001303459.1.81976 NP_649472.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]