SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VP80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VP80
Domain Number 1 Region: 766-962
Classification Level Classification E-value
Superfamily Sec7 domain 1.7e-64
Family Sec7 domain 0.00000533
Further Details:      
 
Domain Number 2 Region: 963-1097
Classification Level Classification E-value
Superfamily PH domain-like 2.2e-18
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9VP80
Sequence length 1325
Comment (tr|Q9VP80|Q9VP80_DROME) Schizo, isoform B {ECO:0000313|EMBL:AAF51675.2} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG32434 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSEADLKNLSQNSDGDQELLLHQTTQSLLMASSIMFVGNQGGPGGSAGGVAPPGPVSLPL
PLSINMPHHHVHAMPYNVDELLRENNALHAKIKELSLERDRLLCEVSNLRLELDMSELKR
LPVDLDDNFPQKSLERSGSTQYELAGAQQPGSANASTCTDSGSVGGYVYLQNHYAPGAHS
SSAAINYPAQQHPQMVYQIQQYPTCHQQQQQQHLQQQQHLHQTGAGHYMQVTATGGGQYH
HHHMLHGHGHHAHHHGGAVVIAGSGVGTGLGSGATSVIMQHQQQQQQQQNMHKKNSIRNG
GDVLKRTRAQSAYELSQDLLEKQIELLERKYGGVRARNAAVTIQRAFRHYMMVKKFASIT
AMAKAEKRLSRRMVVTASSLGLAEEGASSSSAYGSATESQLTEQQQQQQAQQQQQPRVTI
MAGPAGAASPGLSRTPPTRSLSMRERRQLDCSPIPRSQSGASPASISSSTVSTSALASHP
HVNLLHAAEPHYYNAQALPQGAAYYTSYHGSPHDLSYASSADTSLNASWVNTSGHSPHTP
YYSAAQIYMRPKGGSTTPTPSCSGSTGSGSGGSGSGSSKKVPPEVPKRTSSITAQQQTQL
LLLQRQTPPPPSLLRTNGLCKTAENGSLTSVQSSGSDSSVTSAERNLNSDLGSDRSNSPH
TWKRGTALNSSQQFSTHSADSAGAVSGGGVGVAGGAGVYAAQMQAAVAAATAAGGMPPAD
DHAISSHTSAAQYEQHEQQQHEQQQLQAAAAAAGVAQNYKMSETIRKRQYRVGLNLFNKK
PEKGITYLIRRGFLENTPQGVARFLITRKGLSRQMIGEYLGNLQNQFNMAVLSCFAMELD
LSGRQVDVALRKFQAYFRMPGEAQKIERLMEIFSQRYCECNADIVGRLRSSDTIFVLAFA
IIMLNTDLHTPNLKPERRMRVEDFIKNLRGIDDCHDIDKDMLMGIYDRVKSDEFKPGSDH
VTQVMKVQATIVGKKPNLALPHRRLVCYCRLYEIPDVNKKERPGVHQREVFLFNDLLVIT
KIFSKKKTSVTYTFRNSFPLCGTVVTLLDMPNYPFCIQLSQKVDGKILITFNARNEHDRC
KFAEDLKESISEMDEMESLRIEAELERQKSARNRAPGNAENRDSGVADVEVCPCPYQQGS
QASGEQAPNSADNSQQLKRSALSNSLLDMHEQFGNEKPQRRGSVGSLDSGMSISFQSTTT
SSASRENAAAIAAAANAAAAAKMRFNMPPTAAIATPSNVYAAPGMQAYTHANFVQQSQAA
YMLQQQQMLQQQAQMQAQAQAQAQAQAQAQAQAQAQAQAQPLTGRIPGRERKASRTDENG
RSTEV
Download sequence
Identical sequences Q9VP80
FBpp0077947 FBpp0077947 FBpp0110337 NP_730594.1.81976 7227.FBpp0077947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]