SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VPG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q9VPG9
Domain Number - Region: 191-330
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0103
Family MATH domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9VPG9
Sequence length 334
Comment (tr|Q9VPG9|Q9VPG9_DROME) Uncharacterized protein {ECO:0000313|EMBL:AAF51583.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG13247 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MATEEESGSGLFNVTGNPLDTEAAPKLPSEVQKAVCTVTAGEVKASAEAVTTKTLKGVCG
SDEMNMAFRSLENKLYEELRVMKLILVHLAKANGLKLNTAFSPSVTTPPPTMRPITSAAV
PPIFKPIDPPKKLSNSTNSKAEENEVAPDFGLKKTPTLKNLDSNANLGARENEVDKFNNT
VLADQDVKLFTYYWKLENVTELIKAPKLATVSSPIFSFKGKSLQLKCTFHHMNRELLNLQ
LGYGVFNPKSKTGQSNNILLEMDGIFQNTKWTEDIQLKHKISILDQSHTQRRTQDLSSQV
LNKLDTGFSIPNSVLLGSSYIKQNALLIQILLYL
Download sequence
Identical sequences Q9VPG9
NP_649215.1.81976 FBpp0077842 FBpp0077842 7227.FBpp0077842 FBpp0077842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]