SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VPH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VPH1
Domain Number 1 Region: 248-546
Classification Level Classification E-value
Superfamily L domain-like 1.02e-37
Family Ngr ectodomain-like 0.0052
Further Details:      
 
Domain Number 2 Region: 747-889
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 8.76e-37
Family Toll/Interleukin receptor TIR domain 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9VPH1
Sequence length 900
Comment (tr|Q9VPH1|Q9VPH1_DROME) Toll-9, isoform C {ECO:0000313|EMBL:AFH04517.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG5528 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MCPKYIWDVIVLVCLFLGNVREAYTEFSIQDGLIIEPDSATTSSEEAEEVSKERTDLKSL
MLKYESDDGNSCLLDLIKDEVIWWQFPNGTLRDSTKKYAHKLYLDLSHGNLKDDSDLFRE
AKLSRKVTIWRTEVFSAAFNTLTAAPFRTLYSMRESLKLLSLRGNNFAELIPDAEDFARF
VNESRLEASNSVPHHCELLLLHNTTDLYDRECYLYFNNNTNMGQSITTGRNYTNFIKVLK
DRFDQHGSSSQSIAWATFPKMPRLVELDISNCSIEYVSKEAFRNVSNLRRLFMSDNKIMT
ISHDTFYYVQGVQYLDLSFTNFLTYSYQLQLPTLEMALSLIYGLKIQQNVFKYLPELIYL
DLSHSKMTRNSAVAFAHLGDKLKFLSLCYTAIPMVSSTIFKNTVLEGLDLSGNPYLSYNI
IDDAFDGIANTLKYLYFERSNIKDLEWSKSLKNLQVLGLAGNNINALTPAMFQSLESLEI
LDLSSNHVGNWYRSAFHNNSALRVLNLRSNTINMLSNEMLKDFERLDYLSLGDNDFICDC
HLRAVVEVAAANNKDADCSYRLLNYSQNAVGEEVISLAESLIIDRKLWQSRYIPWLQRSY
SNIREFNRANHIIKLRFSSEDYMVAKCSAAQPYHLGDLDGDLTLKFQLLDYEASQYYCFN
NTDQLQVDELNCQIRSMSDLAEELHHVTNTVIAVMGSLVGACILGFIIYLKRWHIHYYYS
SLKSAALLSSASKESVNKFTNISQRDPSAVYDIFISYCQNDRTWVLNELLPNVEETGDVS
ICLHERDFQIGVTILDNIISCMDRSYSLMLIISSKFLLSHWCQFEMYLAQHRIFEVSKEH
LILVFLEDIPRRKRPKTLQYLMDVKTYIKWPTAKEDRKLFWKRLKRSLEVIGINSREISV
Download sequence
Identical sequences Q9VPH1
FBpp0077898 FBpp0300871 NP_001246846.1.81976 NP_649214.1.81976 7227.FBpp0077898 FBpp0077898 FBpp0077898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]