SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VR52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VR52
Domain Number 1 Region: 19-153
Classification Level Classification E-value
Superfamily L domain-like 9.01e-27
Family U2A'-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9VR52
Sequence length 395
Comment (sp|Q9VR52|TILB_DROME) Touch insensitive larva B protein KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=tilB; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MVLITEELVRKKSEHNERLISTLEEISLHQEDIEVIEHIQNWCRDLKILLLQSNLIARLE
NLHKLKRLEYLNVAINNIERVENLEGCESLSKLDLTLNFIRELTSVESLCGNYNLRELVL
IGNPCVDYPHYRDYVVATLPQLNSLDCVEITPSERLRALRELSKNRSIIVQKQVEQDIER
DEQRIRVAKQQSALAEHCAGIEDEEERIKAFWQAKSEHCPEIRTEIARQHRLGRERHETK
SPLDPLKPQRNLFAPCGRPYNLNQAKLPFKFRDEADHYLLQLEVYRHLDTSLIDVDVQTT
YTRVTVKKKIFQIAYSEEVKPDESTVQRSQITGHLVVNLKKLKVNELLIAKKSPTKSPAA
PFDAGKKDGKPEEAFHGGVVDISNICAPEDLPDLI
Download sequence
Identical sequences Q9VR52
FBpp0077037 FBpp0077037 FBpp0077037 NP_608460.1.81976 7227.FBpp0077037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]