SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9VRS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9VRS2
Domain Number 1 Region: 337-441
Classification Level Classification E-value
Superfamily SH2 domain 9.02e-26
Family SH2 domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9VRS2
Sequence length 474
Comment (tr|Q9VRS2|Q9VRS2_DROME) RE37138p {ECO:0000313|EMBL:AAQ23568.1} KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=CG32406 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MPKSEAATMITNNNLDYDQASASSTIIAGATSTTAGTAATSVAMSNRNGSTSSSSNSSPT
ADNSNSNSNSNSNANINRNLNQNPNSNSNTNSNSYFNRFDNRIAANLAAVLTGAGARFRS
SSCSNRHPAGVANPAVLRSPLATISRKTSLATPPSPASLGRRRPLQLFTHANLNCNDNEK
VAQTPSSDEDNSPTELNSCKRLADKPPLVKRLTMGLLRQNEESRPLVGDMTPLSAPLDIQ
PVYSNGYINEDSYIDSKFGDSCRQSLTAIPMLDNVNLNDNNEFNLKKRYLRETSSANSSP
KIFANRLRMNQGAVGQRCSSLANAFGNVGSDEEDLELKDACWYQAGISRDIAVEVLQSKS
PGAFLVRKSSSKPGCYALTLRVPSPPGPKIANYIILRSPRGYKIKGFRKEFSSLKALITH
HSVMPELLPVPLAMPRPTNMSSSRRNLDDFDTYDSLQMLLKYLRAKNMETEQQQ
Download sequence
Identical sequences Q9VRS2
FBpp0076745 7227.FBpp0076745 FBpp0076745 FBpp0076745 NP_729124.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]